KEGG   Streptococcus sobrinus: DK181_03555Help
Entry
DK181_03555       CDS       T05567                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ssob  Streptococcus sobrinus
Pathway
ssob00561  Glycerolipid metabolism
ssob00640  Propanoate metabolism
ssob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DK181_03555
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    DK181_03555
Enzymes [BR:ssob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     DK181_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6 DHQ_synthase Herpes_UL73
Motif
Other DBs
NCBI-ProteinID: AWN18565
Position
693994..695088
Genome map
AA seq 364 aa AA seqDB search
MTTTVMANYSYGEDCYQEIPKVLKSYGIHRVALIGGKRALAATEKEVREILSKAGIETTG
SFVYGVDSTQTNIDKLVAKPAVQEADAIFGFGGGRALDTTKMVAKELDKPTFTFPTICSN
CSAGTAIAVVYKDDHSVLRYGYPNSPLHIFINTRVIAQAPSKYFWAGIGDGISKAPEVEH
AVAEAKKKGLLELPHTATLGHAVALSSKDAFYYYGKQGLEDVKNKRPSKAVEEIALDIVV
STGYASNLVNQPDFYYNSCHAHAFYNGTTAIQRQGEYLHGVVVSYGVLVLHAYFEETDEL
ERVAQFNKELGLPTTLKELGLTQADVPKIVQVALTTNEYKNTPFDGEKFAKAILAVDQLG
QKLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgactgtaatggctaactacagctacggagaagactgttaccaagaaattcca
aaggtgctcaagtcttatgggattcatcgtgtggccctcatcggtggaaagagagctctg
gcggcaacggaaaaagaggttcgagaaatcttgtctaaggccggcattgagacgaccgga
agctttgtctatggggtggattcaacccagaccaatattgataagttagtcgccaaacca
gctgtccaagaggctgatgctatctttggtttcggtggaggtcgtgccttagataccacc
aagatggtcgcaaaggagttagacaaaccaaccttcaccttcccgactatttgttcaaat
tgttcagcagggacagccattgctgtggtctacaaggacgatcattcggtgctccgctac
ggttacccaaactctcctctgcatatctttatcaatactcgcgttattgcccaagcccca
agtaaatatttttgggccggtatcggtgatggaatttctaaggcaccggaagtggagcat
gcagtagcagaagctaagaaaaagggtttgcttgagctccctcatacagcaacattgggt
cacgctgttgccctatcctccaaggatgctttctattattatggtaagcaaggtctggag
gatgtaaaaaataagcgaccttcaaaggcggttgaagaaattgctttggacattgttgtc
tcaacaggttatgcctcaaacttagtcaaccaacctgatttttactacaattcttgccat
gctcacgctttttacaatggaacaacggccattcaacgtcagggtgagtacctgcatggt
gttgttgtatcctatggtgtcttagttcttcacgcctactttgaagaaactgatgagtta
gaaagagttgcccagttcaataaggaactgggactaccaactactctcaaggaattgggt
ttgacgcaagctgacgttcccaagattgtccaagttgccctgacgaccaatgaatataag
aataccccttttgatggtgaaaaatttgccaaagccatcttggctgttgaccaattaggg
caaaagttagcataa

DBGET integrated database retrieval system