KEGG   Saccharolobus solfataricus SARC-C: SULC_0966Help
Entry
SULC_0966         CDS       T03912                                 

Definition
(GenBank) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K18978  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+] [EC:1.2.1.90]
Organism
ssof  Saccharolobus solfataricus SARC-C
Pathway
ssof00010  Glycolysis / Gluconeogenesis
ssof00030  Pentose phosphate pathway
ssof01100  Metabolic pathways
ssof01120  Microbial metabolism in diverse environments
ssof01200  Carbon metabolism
Module
ssof_M00633  Semi-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:ssof00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SULC_0966
   00030 Pentose phosphate pathway
    SULC_0966
Enzymes [BR:ssof01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.90  glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+]
     SULC_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKA76013
UniProt: A0A0E3K5I1
Position
complement(932225..933754)
Genome map
AA seq 509 aa AA seqDB search
MEKTSVLIKSKELMEIYELKDGVPYFKTYLSGQWISGDEWQDVISPIDLNIIGKIPKLNW
NQIDDTLEHIYRKGRWSIRDTPGEKRLDIYKKMASLLDKFKEDFVNVLMINNGKTKSAAE
GEVKAAIERLLRADLDVKETRGDYVPGDWSSETLETEAVVRKEPVGVVLSIVPFNYPLFD
TVNKIVYTTVIGNAIIIKPPSSTPLPILMLAKVMELASFPKDSFAIITIPGRDMNKVVGD
KRIQAISLTGSTETGEEVVRNAGIKQFIMELGGGDPAIVLSDADLAWAAQRIAAGIISYT
GQRCDSVKLVLVEEEVYDTLKDLLIKELTKSVKVGDPRDPLTTVGPVIDVKTVDEWEKAI
KDAVEKGGKILFGGKRLGPTYIEPVLIEAPKETLKDMYFYNKEVFASAALLIKVKNIDEA
LEISNSRKYGLDAAIFGKDINKIRKLQRFLEVGAIYINDYPRHGIGYFPFGGRKDSGIGR
EGIGYTIQYVTAYKSIVYNYKGKGIWEYL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacatcagtgttgataaagtctaaggaacttatggaaatctatgaactaaag
gatggggtgccttactttaagacctatctatcgggtcagtggatcagtggagacgagtgg
caagatgtaattagtccaatcgatttaaatattatagggaaaattcctaaattaaactgg
aatcaaatagatgataccttggagcatatatatagaaaaggaaggtggagtatacgagat
acaccaggtgagaaaaggttagatatatacaagaagatggcgtctttgttagataaattt
aaggaagatttcgttaatgtgctaatgattaataatggtaaaactaagtctgctgcagaa
ggcgaggttaaggctgcaatagaaaggttactacgagcagatctagatgttaaagagaca
agaggagactatgtacccggtgattggagttcagagactttggaaactgaagctgttgta
agaaaagagccagtgggagttgttctttcaattgttccgtttaattatcctctatttgat
actgtaaataaaatagtttatactaccgtaattggaaatgcgataattattaaacctccg
tcatcaaccccattacctatcttaatgttagctaaggttatggaattagcaagttttcct
aaggattcgtttgcgattattacaatacccggtagggatatgaataaggtggtaggagat
aagaggattcaagctatatcattaactggaagtactgaaactggagaagaagtagtaagg
aatgcagggatcaaacaattcataatggaattaggtggaggagacccggctattgttttg
agtgatgcggacttggcgtgggctgcccagagaatagcagctggaataataagttatact
ggtcaaagatgtgattcagtgaagttagttctagttgaagaggaagtttatgatacgctt
aaagatttgcttataaaggaattaacgaaatccgttaaggtcggagaccctagagatccg
ttaaccactgttgggccagtcatagatgtgaaaacagttgatgaatgggaaaaggctata
aaagatgcggtagaaaaaggtgggaaaatattatttggaggtaagagattaggtcctact
tatattgaaccagttttaatagaggcaccaaaagagacccttaaggacatgtacttctat
aataaggaggtatttgcgtccgcagcgcttttaattaaagttaaaaacattgacgaggct
ttagaaatttccaatagtagaaaatatggattagacgcggcaatatttggaaaagatata
aacaagattaggaagctccaaaggttcttagaagtgggtgccatttatataaacgattat
cctagacatggaattggctatttcccgtttggcggaaggaaggattctggaattggcaga
gaggggattgggtatacaattcaatatgtaacagcttacaaatcaatagtctataattat
aaagggaaaggtatttgggaatacttgtaa

DBGET integrated database retrieval system