KEGG   Saccharolobus solfataricus SARC-C: SULC_1888Help
Entry
SULC_1888         CDS       T03912                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ssof  Saccharolobus solfataricus SARC-C
Pathway
ssof00220  Arginine biosynthesis
ssof01100  Metabolic pathways
ssof01110  Biosynthesis of secondary metabolites
ssof01130  Biosynthesis of antibiotics
ssof01230  Biosynthesis of amino acids
Module
ssof_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ssof00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SULC_1888 (argF)
Enzymes [BR:ssof01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SULC_1888 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N DUF4056
Motif
Other DBs
NCBI-ProteinID: AKA76814
UniProt: A0A0E3MGK7
Position
1707219..1708142
Genome map
AA seq 307 aa AA seqDB search
MFRGKSLLCLLDFQTHEIEKMLEVSFLMKSYVYYNKVPNSLSGKRVALLFEKPSTRTRVS
TELAVSLLGGIPIVLNKQDLQWSRGELIEDTGRVLGRVVNGIGARVLNHLTLVKLKESSG
VPVFNLLSDLSHPLQALADLMTIRERFGNNLVKIAFVGDGSDNVLLSLMAIVAKLGLELH
VATPKELKPRDDLYKIISEIAEDTGSVIEFHEDPYEAVRGVHVVYTDVWVSMGQENIAEQ
KKRMLQNYRVTADLMKYAVKDAIFMHCLPANRGEEVDPEVIDGSKSAVWDQAENRLYTTM
AVFSLFI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaggaaaaagtttgttatgtctgcttgattttcaaacacatgaaatagagaaa
atgctagaagtctcattcttgatgaaaagttatgtttattataataaagttccaaattca
ttaagcggtaagagggtcgcattacttttcgagaaaccgagtactaggactagggttagt
actgaattagcagtatcgttattaggtggaattcctattgtccttaataagcaagatttg
caatggtctaggggagagcttatcgaagatactggaagggttttaggcagagtcgttaat
ggaataggggccagagtactaaatcacttaaccctagttaaactaaaggaatcatccgga
gttccagtatttaatttattaagcgatctttctcatcccttgcaagcactagctgactta
atgacaattagggaaaggtttggtaataatcttgtgaagatcgcatttgttggcgatggg
agtgataatgtattattaagcttaatggctattgtggctaaattaggattagagttacat
gtagcaactcctaaagaacttaagcctagggacgatttgtataagataataagtgagatt
gcagaagatactggcagtgttatagaatttcatgaggatccctatgaggctgttaggggt
gtacatgtagtctatactgacgtttgggttagcatgggtcaagagaatattgctgaacag
aagaagagaatgttacaaaactatagggttaccgcagatctaatgaagtatgcggttaaa
gatgcgatatttatgcactgtttgcctgcaaataggggagaggaagtagaccctgaggta
atagatggatctaaaagtgcggtctgggatcaagctgaaaatagattgtatacaacaatg
gcagtattttcattatttatttga

DBGET integrated database retrieval system