KEGG   Saccharolobus solfataricus SARC-B: SULB_1196Help
Entry
SULB_1196         CDS       T03911                                 

Definition
(GenBank) bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ssol  Saccharolobus solfataricus SARC-B
Pathway
ssol00860  Porphyrin and chlorophyll metabolism
ssol01100  Metabolic pathways
ssol01110  Biosynthesis of secondary metabolites
ssol01120  Microbial metabolism in diverse environments
Module
ssol_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ssol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SULB_1196
Enzymes [BR:ssol01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SULB_1196
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SULB_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 TrkA_N Pyr_redox AlaDh_PNT_C Shikimate_DH AdoHcyase_NAD Pyr_redox_2 2-Hacid_dh_C Sirohm_synth_M 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKA73505
UniProt: A0A0E3KC46
Position
1136447..1137094
Genome map
AA seq 215 aa AA seqDB search
MITKDYYPIFIDLSNFRILIIGGGKVGTKRALAFKRYGADVSVLSLDFSQDLLNSDIRLI
RDDANKIDSNLIEKYDIILTCTNNSELNEKLCNIAKNLRKLCNNPTNPENSNFIVPIFYS
DNDLEIAITTRGKSSILAKEILTKTISIANSSEIRNLLGIMYDVKILLKKKVADPSVRYS
LYHKIYNDEKFKYYATNGLINKALNRAEEIINEQG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgattacaaaggattattatccaatttttatagacctttctaattttcgtatacttata
atcggaggaggcaaagtaggtacaaaaagagcgttagcttttaagagatatggagctgac
gtatctgtcttaagtttggatttctcccaagatcttcttaattcagacataagattgatt
agggatgacgcgaataaaatcgatagtaatctaatagaaaaatatgatataattttgact
tgcacgaataattctgaacttaacgagaaactctgtaatatagccaaaaacctaagaaaa
ctttgtaataatcctactaatccagaaaactctaactttatagtaccaatattctattct
gataacgacttagaaatagctataactactagaggaaaatctagtatcttagctaaagaa
atcctaaccaaaacaattagtatagctaacagctcagaaataagaaatttattaggtata
atgtatgatgtaaagattctattaaagaaaaaagtagctgatccatctgttagatattca
ttatatcataaaatatataatgatgaaaaattcaaatattatgctactaatggtttaata
aataaagcattaaatagagcggaggagataattaatgagcaaggatga

DBGET integrated database retrieval system