KEGG   Saccharolobus solfataricus SARC-B: SULB_1635Help
Entry
SULB_1635         CDS       T03911                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ssol  Saccharolobus solfataricus SARC-B
Pathway
ssol00072  Synthesis and degradation of ketone bodies
ssol00280  Valine, leucine and isoleucine degradation
ssol00650  Butanoate metabolism
ssol00900  Terpenoid backbone biosynthesis
ssol01100  Metabolic pathways
ssol01110  Biosynthesis of secondary metabolites
ssol01130  Biosynthesis of antibiotics
Module
ssol_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ssol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SULB_1635
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SULB_1635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SULB_1635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SULB_1635
Enzymes [BR:ssol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SULB_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III HMG_CoA_synt_C Thiolase_C Chal_sti_synt_N
Motif
Other DBs
NCBI-ProteinID: AKA73888
UniProt: A0A0E3GV26
Position
1503739..1504791
Genome map
AA seq 350 aa AA seqDB search
MLSGILGWGAYIPRYRIKVEDIAKMWGYDEAVVKSLGLTEKSVPGHDEDSTTIAWESSIN
AIKRAQVDTSKIRLVLFGSESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLR
LASSFVLHNNDSYALVIGADTAQSNPGDVLELSSAAAGVAFVVGKTDEKHSAAVIEYSSS
YTSDTPDFWRRDGTPYPVHGEGFTGEPAYFHHIISAVNDLLQNSGLKISDFDYFVFHQPN
GKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSG
AGSDAFSILVSEGILAKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKVYE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctctctggtattcttggatggggtgcttatattccaagatatagaataaaagtagag
gatatagctaagatgtggggttatgatgaggcagttgtgaaaagcctcggactgaccgag
aagtctgttcctggtcacgatgaggattctacaactatagcttgggaatcatcgataaat
gcaattaagagagctcaagttgatacttctaagataaggctagtcctttttggttcagaa
tctaaagtttacgctgtaaaacccacttctaccattttaatagacgcactaggcattaac
aattattcagcaactgcggatatggaatttgcatgtagggctgcatcggtaggattaagg
ttagcatcaagtttcgttttacataataacgatagttacgcgttagtaataggtgcagat
actgcacaatctaatccgggggatgttttagaactaagttcggcagcggctggtgttgct
tttgttgttggcaaaactgatgagaaacactcggctgccgtgatagaatattcttcatct
tatacctctgatactccagacttttggcgaagggatggaactccttatccagtccatggt
gagggttttactggagaaccagcttatttccatcatataatttccgctgttaacgatcta
ctacagaatagtggtttaaagatttctgatttcgactattttgtatttcaccagcccaat
ggtaagttcccgatccaagttgctaaaaagctgggtgtcccattagagaaagttaaacaa
gggttagtttctccatatattggtaatccctataatgcttctgccctattaggtttagct
aaagttttggacattgcgaaacctggtgaaaggatcttggttgctccatttggtagtggt
gctggtagtgacgcttttagtattttagtttctgaaggcatattggcgaagcaaaaattg
gctaaaaccgtagaatattatataaataataaaaaactcgtatcttatgctgaatatgct
aaatatactaataagataaaggtgtatgagtaa

DBGET integrated database retrieval system