KEGG   Saccharolobus solfataricus SARC-B: SULB_1715Help
Entry
SULB_1715         CDS       T03911                                 

Definition
(GenBank) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
ssol  Saccharolobus solfataricus SARC-B
Brite
KEGG Orthology (KO) [BR:ssol00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssol03016]
    SULB_1715
Enzymes [BR:ssol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     SULB_1715
Transfer RNA biogenesis [BR:ssol03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    SULB_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3 PSP1
Motif
Other DBs
NCBI-ProteinID: AKA73963
UniProt: A0A0E3K0V5
Structure
PDB: 

Position
1570615..1571244
Genome map
AA seq 209 aa AA seqDB search
MLVWEELREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYTQSSCSGRITIVDAEMP
WDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAR
EAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQ
KMNLLKDLLSSSSNNSMELGKNSKLKTPI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgtgggaggaactaagagagaaagcgcttaataaaatataccatgataaagaa
ataggttacttagatccagatattcttggcttcttactagcattctatagaaacagaaac
gatgtttatacccaaagtagttgtagtgggagaataactattgttgatgcggaaatgcct
tgggataggaaaaactcaactatcatattcaaaaatcatttgagaattacggaacaggat
ctagaggacgttttaagcaaaaatcaagttaggcgactatggttaatagtacaaggaccc
attatacatatttatgctaaaaacattgaaactggctgggatatcttgaaaatcgctaga
gaagctggttttaaacatagtgggattttagctacaaaccaaaagggagtcttagttgaa
ttaagaacgggaataagaatggttcatctcttaagggagtcaaacacagagagagttgac
aaggataaaataaaaacattagtaaatgtatgtaatgaagtgttagcaagaggaaaacaa
aagatgaatctattaaaagacctattatcatctagctccaataattctatggagctgggg
aagaactctaaattgaagacccctatctaa

DBGET integrated database retrieval system