KEGG   Staphylococcus saprophyticus: SSP0325Help
Entry
SSP0325           CDS       T00269                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00071  Fatty acid degradation
ssp00072  Synthesis and degradation of ketone bodies
ssp00280  Valine, leucine and isoleucine degradation
ssp00310  Lysine degradation
ssp00362  Benzoate degradation
ssp00380  Tryptophan metabolism
ssp00620  Pyruvate metabolism
ssp00630  Glyoxylate and dicarboxylate metabolism
ssp00640  Propanoate metabolism
ssp00650  Butanoate metabolism
ssp00900  Terpenoid backbone biosynthesis
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
ssp01212  Fatty acid metabolism
ssp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSP0325
   00630 Glyoxylate and dicarboxylate metabolism
    SSP0325
   00640 Propanoate metabolism
    SSP0325
   00650 Butanoate metabolism
    SSP0325
  Lipid metabolism
   00071 Fatty acid degradation
    SSP0325
   00072 Synthesis and degradation of ketone bodies
    SSP0325
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSP0325
   00310 Lysine degradation
    SSP0325
   00380 Tryptophan metabolism
    SSP0325
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSP0325
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSP0325
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SSP0325
Enzymes [BR:ssp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSP0325
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSP0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE17470
UniProt: Q4A0D5
Position
356042..357193
Genome map
AA seq 383 aa AA seqDB search
MNKIAIVSAKRTPIGRFKGKLSHYSAVELGTKTLEAAIKAINLDSQNIEQVIYGNVLQAG
NGQNPARQIAINAGVPNTTPAMTINEVCGSGLKSIILGKQLIQLGEAKVVAVGGVESMTN
APQLILNDSETPVDSFMHDGLTDAFMNVPMGITAEKIAEKYDVTREAQDAFANESQLKAH
QATQAKKFENEIVPLEDVNGDWMTTDEGIRGNSSVEKLSTLKTIFKEDGTVTGGNASSIN
DGASTIILMDEVYAKENGFEILAFVGAHAEIGCDPELMGYAPYHAVTKLLNQADKAIEDF
DVVEMTEAFAAQSIPVSKNLGIAEEQLNLYGGAIALGHPIGASGTRLVTTLVNILTQEDK
QTGIATACIGGGLGIAIAIEREV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcgcaattgtaagtgctaagcgtacaccgatagggagatttaaaggaaag
ttaagtcattattcagcagtagaacttggcactaaaacattggaagctgctataaaagct
ataaatttagattcacaaaatattgagcaagtcatatatggtaatgtactacaagctggc
aatggacaaaatccagcacgtcaaatcgctattaatgctggcgtgcctaatacaacacca
gctatgacaataaatgaagtctgtggttcaggattgaaatccattattttaggaaaacaa
ttaatacaattaggtgaagccaaagtcgtagcagttggcggtgttgaaagtatgacgaat
gcgcctcaactcattttaaatgacagtgaaacacctgttgatagctttatgcatgatggt
cttactgatgcctttatgaatgtacctatgggtattacagcggaaaaaattgctgaaaaa
tatgatgtgacacgtgaagcgcaagatgcgtttgctaatgaatcacaactgaaagcacat
caagccacacaagctaagaaatttgaaaatgaaattgtacctttagaagatgtaaacgga
gactggatgaccacagatgaaggtattcgtggcaatagtagtgttgaaaaattaagtaca
ctaaaaacaatctttaaagaagacggtactgtgacaggtggcaatgcttcaagcattaat
gatggggcatcaacaattatcttgatggatgaagtttatgccaaagaaaatggttttgaa
atattagcatttgttggagcacatgcagaaataggctgtgatccagagttaatgggttat
gcaccatatcatgcagttacaaaattattaaaccaagctgataaagcgatagaagacttt
gatgtggttgaaatgacagaagcttttgcggcgcagagtataccagtaagtaaaaatcta
ggtatagctgaagaacaactcaatttatatggtggagcgattgccttgggacaccctata
ggtgcaagtggtacgcgtttagttacaacacttgtaaatattttaacacaagaagataaa
caaacaggcattgctactgcttgtattggtggcggtttaggtatcgctattgctatagaa
agagaggtttaa

DBGET integrated database retrieval system