KEGG   Staphylococcus saprophyticus: SSP0398Help
Entry
SSP0398           CDS       T00269                                 

Definition
(GenBank) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00030  Pentose phosphate pathway
ssp00051  Fructose and mannose metabolism
ssp00680  Methane metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
Module
ssp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP0398
   00030 Pentose phosphate pathway
    SSP0398
   00051 Fructose and mannose metabolism
    SSP0398
  Energy metabolism
   00680 Methane metabolism
    SSP0398
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SSP0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: BAE17543
UniProt: Q4A071
Position
complement(434306..436258)
Genome map
AA seq 650 aa AA seqDB search
MQKSADKSLKDRYLDLLSQQFNTKEELATEIINLESILELPKGTEHFVSDLHGEFHAFQH
VLRNGSGNVRSKINDIFQDTLTRKEINEFSALVYYPEEKLKIIKNSFSSKSELNEWYITT
INRLIKLITYASSKYTRTKLRKSLPKNYVFIIEELLYKSNKYNNKHSYYETLINQIIELE
QSDDLIIGLSFTVQHLVVDHLHVVGDIYDRGPEPDKIMETLIDYPSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEKHYDGKNKAFRPKNAEGLT
ELELEQITKIHQAIAIIQFKLEAPIIKRRPTFEMEERLVLESINYEKNEATLYGKTYPLE
NTCFQTIDPNGPNKLTDEESEVMDKLLLSVQQSEKLKRHMTFLMQKGTLYLPYNGNLLIH
GCIPVDENGEMESMVINDVKCYGRDLLDHFEDYVREAFDHKDIQDDLATDLVWYLWTGKY
SSLFGKRAMTTFERYFIKDKTAHKETKNPYYHLREDVNMCKKMLKDFGLDPEQGHIINGH
TPVKEIDGEDPIKAEGKMIVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQHFNSKKH
VLLNGADELSIRRVVDKELQRQKIRHTNTGQDIQEKIDILKELMHDRYVN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatcagcagataagagcctaaaagatagatatttagatttactttcacaacaa
tttaatactaaagaagaacttgcaacagaaattattaatttagagtctattttggaactc
cctaaaggtactgaacattttgtaagtgatttacacggtgaatttcatgcctttcaacac
gtattgcgtaatggttcaggcaacgttcgttcaaaaattaatgatatcttccaagatact
ttgacacgcaaagaaattaatgaattttctgcgcttgtatactatcctgaagaaaaactt
aaaataattaaaaacagctttagctcaaaatccgagctcaatgagtggtacattacaacg
attaatcgtctgataaaactaatcacctatgcttcatccaaatacacgcgcacaaagtta
cgcaaatctttaccaaaaaattacgtctttattatagaagaactgttatataaaagtaat
aaatataataataaacattcttattatgaaacattaattaatcaaatcatagagctagaa
caatcagatgatttgatcattggcttatctttcacagttcagcaccttgtagtggatcac
cttcatgttgttggcgatatctacgacagaggaccagaacctgataaaattatggaaaca
ctgattgattatccttcagtagatattcaatggggaaatcatgatgtcctttggattggt
gcctatgcaggttccaaagtttgccttgcaaacctacttcgcatttgtgcacgttatgat
aacttagacattatcgaggatgcttatggtatcaatttaagacccttattaacccttgca
gaaaaacattatgatggaaaaaacaaagcattcagacctaaaaatgctgaaggcttaact
gaattagaacttgaacaaatcacaaaaattcatcaagccatcgccatcatacaatttaaa
ttagaggcaccaatcattaaacgtcgccctacttttgaaatggaagaacgattggtatta
gaaagtattaattatgaaaaaaatgaagcaacactctatggaaaaacatatccattagaa
aatacttgtttccaaacgattgacccaaatggtccaaacaaactcacagacgaagagtca
gaagtgatggataaactattattatctgtccaacaatcagaaaaattgaaacgacatatg
accttccttatgcaaaaaggcacgctttacctaccttataacggtaatttattgattcac
ggctgtattccagtagatgaaaatggtgaaatggaatcaatggttatcaacgatgtgaaa
tgctatggcagagatttattagaccattttgaagattacgtcagagaagcttttgatcac
aaagatattcaagacgatttagccacagatttagtatggtatctttggactggtaaatac
tcttcactatttggcaaacgcgctatgacgactttcgagcgttactttattaaagacaaa
acagcgcataaagaaactaaaaacccttactaccatttgcgtgaggatgttaatatgtgt
aaaaaaatgctcaaagattttggcttagaccctgaacaagggcacattatcaatgggcat
acacctgtcaaagaaatagatggtgaagatccaattaaagctgaaggaaaaatgattgtg
attgatggaggcttttcgaaagcttatcagtcaacaacaggtatcgcaggttatacatta
ctttataattcatttggtatgcaactagtcgcacaccaacattttaattccaaaaaacat
gttttactgaatggcgctgatgaactttctatacgtcgtgtcgtcgataaggagttacaa
cgacaaaaaataagacatacaaacaccggacaagatattcaagaaaaaatcgatatttta
aaagaacttatgcatgatcgttatgttaactaa

DBGET integrated database retrieval system