KEGG   Staphylococcus saprophyticus: SSP0483Help
Entry
SSP0483           CDS       T00269                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00260  Glycine, serine and threonine metabolism
ssp00680  Methane metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
ssp01230  Biosynthesis of amino acids
Module
ssp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssp_M00002  Glycolysis, core module involving three-carbon compounds
ssp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP0483
  Energy metabolism
   00680 Methane metabolism
    SSP0483
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSP0483
Enzymes [BR:ssp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSP0483
Membrane trafficking [BR:ssp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSP0483
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSP0483
  Exosomal proteins of melanoma cells
   SSP0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAE17628
UniProt: Q49ZZ2
Position
518971..519657
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSEQGENEAITSGKKLKAQGIEIDIVYTSLLER
AIKTTYHLLNESNQLFIPIIKSWRLNERHYGGLQGLNKDDARKKFGEDQVHIWRRSYDVA
PPKQDEAQRESYLNDRKYEHLDRRVMPESESLKDTLVRVIPYWNDQISQQLLDGKTVLVS
AHGNSLRALIKYLENVSDEDIVGYEIKTGAPLIYELTDDLQVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtagacatggacaaagtgtgtggaatgcagaaaacctattt
acaggatgggcagatgttgatctatcagaacagggcgaaaatgaagccataacatctggt
aaaaaattaaaagcacaaggcattgaaatcgatatagtttatacatctttactcgaacgt
gcgattaaaacaacttatcacttattaaatgaatctaatcaattatttattcctataatt
aaatcttggagattaaatgaaagacattatggtggtttacaaggactaaataaagatgat
gcacgtaaaaagtttggtgaagatcaagtacatatttggagacgttcatatgatgttgca
ccgccaaaacaagatgaagcacaacgagaaagttatttaaatgaccgtaaatatgaacat
ttggatagacgtgtcatgcctgaatctgaaagcctaaaagatacgttagtaagagtgata
ccgtattggaacgatcaaatttctcaacaacttttagatggtaaaacagtgttagtatca
gctcatggtaattcattacgtgcattgattaagtatttagagaatgtttctgatgaagat
atcgttggatatgaaattaaaacaggtgcaccattaatatatgaacttacagatgactta
caagttatagacaaatattacttataa

DBGET integrated database retrieval system