KEGG   Staphylococcus saprophyticus: SSP0539Help
Entry
SSP0539           CDS       T00269                                 

Definition
(GenBank) putative malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00020  Citrate cycle (TCA cycle)
ssp00620  Pyruvate metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
Module
ssp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSP0539
   00620 Pyruvate metabolism
    SSP0539
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SSP0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like K_oxygenase MCRA Pyr_redox PRD Pyr_redox_2 FAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAE17684
UniProt: Q49ZU0
Position
572992..574470
Genome map
AA seq 492 aa AA seqDB search
MSTQHSKTDVILIGGGIMSATLGTILKEIAPEKEIKMYERLSTPAEESSNAWNNAGTGHS
ALCELNYTSENKDGTIDIKKAVKINEQFQVSKQFWSYLVKQGQLDHPEAFIKPVPHMSFV
QGIKNVDFLKRRVEKLNKNILFSNMEITDNKDKITEWTPLIMEGRTSNIPMAISYDKTGT
DVNFSALTKKLFENLEDKDVALNYKHEVEDIKQRKDGVWEVKVKNLDTNTIEIVESDFVF
IGAGGASLPLLQKTGIKESKHIGGFPVSGLFLVCRDEAITKKHLAKVYGKAPVGAPPMSV
PHLDTRYIDGKRTILFGPFAGFSPKFLKTGSNMDLIKSVKPNNIITMLSAGIKEMNLTKY
LISQLTLSNEERMEDLRQFVPNAKSEDWEVVVAGQRVQVIKDTDQGKGTLQFGTEVITSE
DGSLSALLGASPGASTAVDIMLDLLKRCYKDEFEGWEEKIKEMVPSFGMKLSENEALYTQ
LNKEITKYLKIN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacaacatagcaaaacagatgtcatcttaattggtggcggtatcatgagcgca
acactagggacgattttaaaagaaatcgctcctgagaaagaaattaagatgtatgaaagg
ttatcaacacctgctgaagaaagttcgaatgcgtggaataatgcgggcacagggcactct
gcattatgtgaattaaattatacgagcgaaaataaagacggcacaattgatatcaaaaaa
gcggttaaaatcaatgaacaatttcaagtttccaaacagttttggagctatctagtgaaa
caagggcaactcgatcatccagaagcatttattaaaccagtgcctcacatgagctttgtt
caagggattaaaaatgtagactttttgaaaagacgtgtagaaaaactaaataaaaacatt
ttatttagtaatatggaaatcacggacaataaagataagataactgaatggacgccttta
attatggaaggacgtacctctaatatccccatggcgattagttatgataaaacaggtaca
gacgttaacttcagtgcattgactaaaaaattatttgaaaatttagaagataaagatgta
gcattaaattataaacacgaagttgaagacattaaacagcgtaaagacggtgtttgggaa
gtgaaagttaaaaatcttgatacaaacactatagaaattgtagaaagcgactttgtattt
atcggtgcaggtggcgcaagtttaccattattacaaaaaacaggtatcaaagaatctaaa
catataggaggattcccagttagtgggctcttcttagtgtgtagagatgaagcgattacc
aaaaaacatttagctaaagtatacggtaaggcaccagtcggcgcgccgccaatgtctgta
ccacatttagatacacgctatatagatggtaaacgcacaattttatttggaccttttgct
ggtttttcaccgaagtttttaaaaacaggttcaaatatggatttaatcaagtctgttaaa
cctaataacataattaccatgctttctgcgggaattaaagagatgaatttaacgaaatat
cttatttcacaacttaccttatccaacgaagaacgtatggaagatttacgtcaatttgta
ccgaacgcaaagagtgaggattgggaagttgttgttgcaggacaaagagtacaagtaatc
aaagatactgatcaaggtaaaggtaccttacaattcggtacagaagtcatcacttctgaa
gatggctcattatctgcattacttggtgcttcacctggcgcttctacggcggtagatatt
atgttagatttattgaaacgttgctataaagatgaatttgaaggttgggaagaaaaaatt
aaagaaatggttccttctttcggtatgaaattatctgagaatgaagcactttatacgcaa
ttaaacaaagagattacgaaatatcttaaaattaactag

DBGET integrated database retrieval system