KEGG   Staphylococcus saprophyticus: SSP0592Help
Entry
SSP0592           CDS       T00269                                 

Definition
(GenBank) alkaline phosphatase III precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00730  Thiamine metabolism
ssp00790  Folate biosynthesis
ssp01100  Metabolic pathways
ssp02020  Two-component system
Module
ssp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SSP0592
   00790 Folate biosynthesis
    SSP0592
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSP0592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssp04147]
    SSP0592
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssp00537]
    SSP0592
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SSP0592
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSP0592
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssp00537]
 Enzymes
  SSP0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase CorA
Motif
Other DBs
NCBI-ProteinID: BAE17737
UniProt: Q49ZN9
Position
628736..630169
Genome map
AA seq 477 aa AA seqDB search
MKIFNRLATISVASAIVAGTALGSAQPTYASGGGQDSNQNDEVSYMGNTKNPKNVIFLVG
DGMGPSYNSAYRYFADNPETKEMDKTAFDHYLAGNQRTNPDDPKENVTDSAAGATAFSSG
HKTYNGAIGVDENKKDVKTVLEQAKENGKSTGLVSTAELTDATPAAYASHVDDRDKKDEI
AQQFYNDKINGQHKVDVLLGGGAEYFGKENGNLTDKLKKDGYDIVKNKSQMQNSNSKQIL
GLFADNDMPLQIDAPKQNPKLVDMTDTAVNKLKQNDKGFFLMVEGASIDKSGHPNDVTGV
MSEMQGFEKAFDYATQYAKANPDTLVVATADHSTGGLSIAKGKDYVWNPDAIHSMKHSGS
YMTKQIASGKDAAKVIKEGYGFDVKQSQIDKINEEAKKLKDLDEDDEKYKDQLQKLQDAV
QKPINDKSNTGWTTYGHTGEDVNTYAFGPGSDRFQGNIDNTDNAKNIFDFFKNDQSS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttcaataggttagcaactatttctgtagcaagtgcaattgtggctggtaca
gcattggggagtgcacaaccaacttatgcatcaggcggaggacaagattcaaatcaaaat
gatgaagtttcatatatgggaaatactaaaaatcctaaaaatgtgattttccttgtgggc
gatggtatgggaccttcatataactctgcataccgttattttgcagataatcctgaaaca
aaagaaatggataaaacagcatttgatcattatttagcaggtaaccaacgtacaaatcca
gatgatccaaaagaaaatgtaacggattcagctgctggggcaactgcttttagttctggt
cataaaacatataatggtgcaattggtgttgatgaaaataaaaaggatgttaaaactgtt
ttagaacaagctaaagaaaatggtaagtcaactggacttgtgtctactgctgaacttacg
gatgctacaccagcagcttatgcgtcacatgttgatgatcgtgataaaaaagatgaaatt
gcgcaacaattttataatgataaaataaatggccaacacaaagtggacgtgctacttggt
ggcggtgctgaatatttcggaaaagagaatggtaacctcacagataaattaaaaaaagat
ggttatgatattgtgaagaataaatcgcaaatgcaaaactctaatagcaagcaaatacta
ggtttatttgcagataatgatatgcctttacaaattgatgcaccaaaacaaaatccaaaa
cttgttgatatgacagatactgctgttaataaattgaaacaaaatgataaaggattcttc
ttaatggtagagggtgcttcaattgataaatctggtcatcctaatgatgttactggcgta
atgtctgaaatgcaaggttttgaaaaagcatttgactatgcaacacaatacgctaaagca
aatccagatacgctagtcgttgcgactgctgaccattcaacaggtgggttatccattgct
aagggtaaagactacgtttggaatccagatgcgattcactcaatgaaacattcaggttct
tatatgacaaagcaaattgctagtggtaaagacgctgcgaaagtcattaaagagggttat
ggatttgatgtaaaacaaagtcaaattgataaaattaatgaagaagctaaaaaattaaaa
gatcttgatgaagatgacgaaaaatataaagatcaattacaaaaactacaagatgcagta
caaaaaccaattaacgataagtctaatactggatggacaacgtatggtcatactggtgaa
gatgtaaatacttatgcatttggtccaggtagtgaccgattccaaggtaacattgataat
acagataatgccaaaaacatctttgattttttcaaaaatgatcaatcatcttaa

DBGET integrated database retrieval system