KEGG   Staphylococcus saprophyticus: SSP0694Help
Entry
SSP0694           CDS       T00269                                 

Definition
(GenBank) tRNA pseudouridine synthase A
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
ssp  Staphylococcus saprophyticus
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssp03016]
    SSP0694
Enzymes [BR:ssp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     SSP0694
Transfer RNA biogenesis [BR:ssp03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    SSP0694
 Prokaryotic type
    SSP0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: BAE17839
UniProt: Q49ZD7
Position
715746..716549
Genome map
AA seq 267 aa AA seqDB search
MRVLVNISYQGSQFLGFQIQQHGRTIQQQFEKILKRMHKHEVRIHPSSRTDRGVHAIEQY
FHFDTELNIPEQQWQYAMNRALPDDIYVNDVSFVNDDFHCRYDCVGKSYRYKIYQSAHKD
PFLCGLKTYVPEQLDIEKMNMAAQHFIGTHDFTGFCSQKTEVESKIRTLYESRIEKTESG
FDYIVTGSGFLYNMVRVLIAFLIEVGKGKREPQEVPQLLEARDRNQVPFTAPAEGLYLEK
IYLTPNELIQDFGNNIKIHQKKSSQNL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcttagttaatatttcataccaagggagccagtttcttggtttccaaattcag
caacacggaagaaccattcaacagcaatttgaaaagatattaaaacgcatgcataagcat
gaggtaagaatacatccaagtagtagaaccgacagaggcgtacatgcgattgaacagtat
tttcattttgatacagaattaaatattccagaacagcaatggcaatatgcaatgaaccgt
gcgctaccagatgatatttatgtcaatgatgtttcttttgttaatgatgattttcattgt
agatatgattgcgttggaaaatcttatcgttataagatttatcaatcagcccataaagat
ccatttctttgtggattaaaaacttatgtgcctgaacagttagatattgaaaagatgaat
atggcagctcaacattttataggcacacatgatttcacaggcttttgttctcagaagact
gaggttgaaagtaagataagaacattatatgaaagtcgcatagaaaagacagaaagtggc
tttgactatattgtcacaggctctggattcctatataatatggtacgtgtgttaattgca
tttttaatagaagtgggtaaaggcaagagagaaccacaagaggtcccacagttattagaa
gcaagagatcgtaatcaagttccctttaccgcaccggctgaaggattgtacttagagaag
atttatttaacacccaatgaattaattcaagactttggtaataatataaaaatacatcaa
aaaaaatcatcacaaaatctttaa

DBGET integrated database retrieval system