KEGG   Staphylococcus saprophyticus: SSP1387Help
Entry
SSP1387           CDS       T00269                                 

Definition
(GenBank) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssp00401  Novobiocin biosynthesis
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01130  Biosynthesis of antibiotics
ssp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSP1387
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SSP1387
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SSP1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH ACT F420_oxidored NAD_binding_2 GFO_IDH_MocA DapB_N ACT_4 TrkA_N ACT_6 NAD_Gly3P_dh_N Pectate_lyase_3 ApbA IlvN ACT_7 THF_DHG_CYH_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAE18532
UniProt: Q49XG5
Position
1430243..1431334
Genome map
AA seq 363 aa AA seqDB search
MKQILFVGLGLIGGSLASNLRYYHDDIEITAFDADTSQLDKALSIGIIDYQSTDYKTSVE
NADIIIYATPVQQTVKYLQDLPNYQLKKHVIITDTGSTKSTIQQYEQFLLNHDIHLVGGH
PMAGSHKSGVLNAKKHLFENAFYILVHNETDNDAAFEEIQHLLQTTSAKFISTTAEEHDF
VTGIVSHVPHIIASSLVHLNAQHVEDSSLVKTLAAGGFRDITRIASSNPIMWRDITIENK
NTILRILKEWKNQMSDVINIIEHNNPDELYDFFNDAKVYRDQLPLKQQGALSVEYDLYVD
IPDKPGMISKVTNILSLHNISISNLRILEVREDIYGALRVSFKNPQDRKDGADALSDFDT
YFD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattcttttcgttggcttaggccttattggcggaagcttagcgagtaactta
agatattatcatgatgatatcgaaataaccgcctttgatgcggatacttcacaattagat
aaagcattgtctattggtatcatagattatcaatcaactgactataaaactagtgttgaa
aatgctgacattattatttatgcaacaccggtacagcagactgttaaatacttacaagat
ttaccaaactatcaactaaaaaaacatgtaattattacagatactggaagtacaaagtca
acgattcaacaatatgagcagtttcttttaaatcatgatattcatttggttggcggccat
cctatggcaggaagccataaatctggagtattaaatgcaaaaaaacatttatttgaaaat
gctttttatattttagttcataatgaaactgataatgatgctgcttttgaggaaatacag
cacttattacaaacaacgagtgctaaatttatttctacaacagcggaagaacatgatttt
gtcactggtattgtgagtcacgtccctcatatcattgcttcaagtctcgttcatttgaat
gcgcaacatgtcgaagattcttcacttgttaagacgcttgcagctggtggttttagagat
attactagaatcgcaagtagtaatcctattatgtggcgtgatattactattgaaaataaa
aatacaatattgcgcattttaaaagaatggaaaaatcaaatgtctgatgtcattaatata
atcgaacacaataatcctgatgaactttatgattttttcaacgatgctaaagtttatcgt
gatcagttaccccttaaacaacaaggtgcactatctgtggagtatgatctatatgtagac
attccggataaaccgggtatgataagcaaagttacaaacatcctaagtttacataatatt
tctataagcaacttgagaatattagaagttcgtgaagatatttatggtgcacttcgagtt
agttttaaaaacccacaagatcgcaaagatggtgcagatgcgcttagtgattttgatact
tattttgattaa

DBGET integrated database retrieval system