KEGG   Staphylococcus saprophyticus: SSP1455Help
Entry
SSP1455           CDS       T00269                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00480  Glutathione metabolism
ssp00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSP1455
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSP1455
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSP1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAE18600
UniProt: Q49X98
Position
1506071..1506544
Genome map
AA seq 157 aa AA seqDB search
MTIYDIEVQKPNGDAYKLDAYKNKVMLIVNTASECGFTPQFEGLQALYDKYKDQDFIILG
FPCNQFGGQEPGTGEEATQNCKINYGVSFPMHEKIDVKGEQQHPLFKFLTEAQNGFFNEK
IKWNFTKFLVDKNGDVVQRFSPQKKPSQLESEIEALL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactatttacgacatagaagtacaaaaaccaaatggagatgcttataaattagatgct
tataaaaacaaagtgatgttaattgtaaacacggctagtgaatgtggatttacaccacaa
tttgaagggctacaagcattatatgataagtataaagatcaagatttcatcattttagga
ttcccttgtaatcaatttggtggccaagaacctggtacaggtgaggaagctactcaaaac
tgtaaaatcaattacggtgtttctttcccaatgcatgaaaaaattgatgttaaaggtgaa
caacaacatcctctatttaaatttttaactgaagctcaaaatggatttttcaatgaaaaa
ataaaatggaatttcactaaatttttagtggataaaaatggcgatgtggttcaacgtttt
tcaccacagaaaaaaccaagtcaattggaatcagaaattgaagcattactataa

DBGET integrated database retrieval system