KEGG   Staphylococcus saprophyticus: SSP1504Help
Entry
SSP1504           CDS       T00269                                 

Definition
(GenBank) DNA polymerase III alpha chain PolC-type
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp03030  DNA replication
ssp03430  Mismatch repair
ssp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SSP1504
   03430 Mismatch repair
    SSP1504
   03440 Homologous recombination
    SSP1504
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssp03032]
    SSP1504
   03400 DNA repair and recombination proteins [BR:ssp03400]
    SSP1504
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SSP1504
DNA replication proteins [BR:ssp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SSP1504
DNA repair and recombination proteins [BR:ssp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SSP1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha PHP RNase_T DNA_pol3_finger DNA_pol3_a_NII DNA_pol3_a_NI HHH_6 HHH_3 tRNA_anti-codon RNase_H_2 DUF3091
Motif
Other DBs
NCBI-ProteinID: BAE18649
UniProt: Q49X49
Position
complement(1558499..1562815)
Genome map
AA seq 1438 aa AA seqDB search
MAMTNEEKFKILADQIKITEHLDSEILENSELTRVDVKTSDRTWVFQITFPHFLTIENYL
LFTGAIIEEFKTIADVKCNFTVKDKTNQDEFAIKYFSHCIDQTKLSPKVKGQLKQKRLIM
SGDVLKVMCQNDVERDHFDKACNGSLIAAYQQCGFNISKVVFETDSAVNDGDLASLEAHI
QEEDEKSAREATEKLEKMKAEKAKQQDNNESDVSKCQIGKPIQVENVRQIDSIIEEEFKA
AVEGVIFDINLKELKSGRHIVELKVTDYTDSLVLKMFTRKNKDDLAHFKALSVGKWVRAQ
GRIEEDTFVRDLVMMMSDIEEIKKATKQDKAEDKRVEFHLHTSMSQMDGIPNISDYVDQA
AKWGHKAIAVTDHNVVQAFPDAHSAAEKNGIKMIYGMEGMLVDDGVPIAYKPKDCDLKTA
TYVVFDVETTGLSNQYDKIIELAAVKVKDGEIIDKFERFSNPHERLSETIKNLTHISDDM
LVDAPEIEEVLTEFKSWVGDAIFVAHNASFDMGFIDTGYEHVGIGASTNGVIDTLELSRT
INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYMFIKMLKQLEALGVHNHQDINTSL
SNEDAYKRARPNHVTLIVQNQDGLKNLFKIVSASLVQYYYRTPRIPRSLLDEYREGILVG
SACDEGEVFTAVMQKDQSQVERIAKYYDFIEVQPPALYQDLIDRELVRDNETLHEIYNRL
IRAGDVNNIPVIATGNAHYLNEHDAIARKILIAAQPGNPLNRSTLPKAHFRTTDEMLDEL
HFLGEEKAYELVVQNTNDLADKIERVVPIKDELFTPRMEGANEEIREMSYDNAKALYGDD
LPQIVIDRLEKELESIIGNGFSVIYLISQRLVKKSLNDGYLVGSRGSVGSSFVATMTEIT
EVNPLPPHYICPECKQSEFFDDGSVGSGFDLPDKKCESCGCDLIKEGQDIPFETFLGFKG
DKVPDIDLNFSGEYQPEAHNYTKELFGEDKVFRAGTIGTVAEKTAFGFVKGYLNDQGIHK
RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPVQFPADDQGSSWMTTHFDFH
SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKETMGIFSSPEPLGVTSDEILC
KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVRISGLSHGTDVWLGNAQDLIRSGKCDLAS
VICCRDDIMVYLMYNGLEPSLAFKTMEFVRKGKGLTDDMVEAMVDNEVPDWYLDSCRKIK
YMFPKAHAAAYVLMAVRIAYFKVHYPLYYYASYFTVRASDFDLISMIKDKESIRNTVNDM
YSRYMDLAKKEKDTLTVLEIMNEMAQRGYRMQPISLEKSKAFEFIIEGDTLIPPFIAVPG
LGENVAQRIVEARDEGPFLSKEDLNKKAGLSQKVIEYLDELGSLPNLPDKAQLSIFDM
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacaaatgaggaaaaatttaaaatactagctgaccaaatcaaaattactgag
catttagattcagaaatattggaaaatagtgaattaacacgtgttgatgtcaaaacatca
gatcgaacttgggtatttcaaattacattcccacattttttaacaattgaaaattatttg
ctttttacaggtgcaatcattgaagaatttaaaacgattgcagatgtaaaatgtaatttc
acggtaaaagataaaacaaatcaagatgaatttgcaataaaatattttagccactgtatt
gatcaaacaaaattatcacccaaagtaaaaggacaattaaaacaaaaacgcttaattatg
tcaggtgatgtattaaaagtcatgtgccaaaacgatgttgaacgagatcactttgataaa
gcgtgtaatggtagtttgattgcagcataccaacagtgtgggtttaatataagtaaagtc
gttttcgaaacagatagtgcagttaacgatggggatttagcgtcattagaagcacatatt
caagaagaagatgagaaaagtgcgcgtgaagcaacagaaaaattagagaaaatgaaggct
gaaaaagcaaaacaacaggacaataacgaaagtgatgtttcaaaatgtcaaattggtaaa
ccaatccaagttgaaaatgtacgtcaaattgactcaattatcgaagaagaatttaaagct
gctgtagaaggtgttattttcgatatcaatttaaaagaattgaagagtgggcgtcatatt
gtagaattaaaagtaacagattatacagattctcttgtcttgaaaatgttcacacgtaaa
aataaagatgatttagcgcattttaaagctttaagtgtaggtaaatgggttcgtgcacaa
gggcgtattgaggaagatacatttgtacgtgacctagttatgatgatgtcagatatcgaa
gaaataaaaaaagctacaaaacaagataaagctgaagacaaacgtgttgaattccattta
catacgtcaatgagtcaaatggatggtattccaaacatatcagattatgtagatcaagct
gcgaaatggggacataaagccattgcggtaacagaccataatgttgtgcaagcattccca
gatgcacatagtgctgccgaaaaaaatggaattaaaatgatttatggcatggaaggtatg
ctggtagatgatggtgtaccaatcgcatataaaccaaaagattgtgacctaaaaacagct
acttatgtagtatttgacgttgagacaacgggactttcaaatcaatacgataaaattatt
gaacttgcagctgttaaagtaaaagacggcgaaattattgataaatttgaacgattcagt
aatcctcatgaacgattgtcagaaacaattaaaaacttaacgcatatttcagatgacatg
ttagtagatgcccctgaaatagaagaagtgcttactgagtttaaatcatgggtaggcgac
gccatttttgtagcgcataatgcatcatttgatatgggcttcatcgatacaggttatgaa
cacgttggcattggtgcttccacgaacggcgtcattgatacattagaattatctagaaca
attaatacagaatatggtaagcatggcttaaatttcttagctaaaaaatacggggttgaa
ttaacgcaacaccatagagcgatatatgatacagaagcaacggcttatatgttcataaaa
atgcttaagcagctagaagcgcttggtgttcacaaccatcaagatatcaatacgtcattg
tcaaatgaagatgcgtataagcgtgcacgaccaaatcatgtaacactcattgtgcagaac
caagatggtttgaaaaatctatttaaaattgtgagtgcatctcttgttcaatattattac
cgtacaccaagaattccacgttccttgttggatgagtatagagaaggaatacttgtaggc
tctgcgtgtgatgagggcgaagtatttacagcagttatgcaaaaagaccagtctcaagta
gagcgaattgccaaatattacgattttattgaggttcaaccgccagcactttatcaagat
ctaattgatagagagctagtaagagataatgaaactttacatgaaatttataatcgttta
attcgagcgggggatgtaaataatattccagtgattgcaacaggtaatgcacattattta
aatgaacatgatgcgattgctcgtaaaatattaattgccgctcaaccgggtaatccatta
aatcgctctactttaccaaaagcgcattttagaacaacggatgaaatgttagatgaatta
cactttttaggtgaggaaaaagcatatgaacttgtagttcagaatacgaatgatttagca
gataaaatagaacgtgtcgtaccaattaaagatgaactattcacaccgagaatggaaggt
gcgaatgaagaaatacgtgaaatgagttacgataatgcaaaagcactttacggcgatgat
ttaccacagattgtcattgatcgtttagagaaagaattggaaagtattataggtaatggt
ttctcagtaatatatttaatttctcaaagattagttaaaaaatcactgaatgatggttac
ttagtaggttcacgtggttctgttggttcgagctttgtggcaacaatgactgaaattaca
gaagtgaatcccctaccaccacattatatttgtccagagtgtaagcaaagtgagttcttt
gatgatggttctgttggttcaggattcgatttaccagacaagaaatgtgaatcgtgcggt
tgtgatttgattaaagaaggccaggatattccattcgaaactttcttaggatttaaaggg
gataaagtacctgatattgacttgaactttagtggtgaatatcaacctgaagcgcataac
tatactaaagagctatttggtgaagataaagtatttcgtgcgggaacgatcggtacggtt
gcagaaaaaactgcttttggttttgtgaagggatatttaaacgatcaaggtattcataaa
cgaggagcagaaatagacagacttgtaaaaggttgtactggtgttaaacgtacgactgga
caacatccaggtggtattattgttgttcccgattatatggatatttacgattttacacct
gttcaattcccagcagatgatcaaggttcttcttggatgacaacgcactttgatttccat
tccattcatgataatgtgttgaaattggatatactgggtcacgatgatcctactatgata
cgtatgttgcaagatttgtcaggtattgatccaaaaacgattccagtagatgataaggag
acgatgggcatttttagttcgccagagcctttaggtgtcacttccgatgaaattttatgt
aaaacaggtacatttggtgtaccagaattcggaactggatttgttagacaaatgttagaa
gatacgaaaccaacaacattttctgaattagttagaatttcagggctatctcatggtacg
gatgtatggttaggtaatgcacaggatttaatacgctctggtaaatgcgatttagcaagt
gtaatttgttgtcgtgatgatatcatggtctacttgatgtataacggtttggaaccttca
ttagcctttaaaacaatggaatttgttcgtaagggtaaaggtttaactgatgatatggta
gaagcgatggttgataatgaagtgccagattggtacttagactcatgtagaaagattaaa
tacatgttccctaaagcccacgcagcagcttatgtactaatggctgtacgtattgcttat
ttcaaagtgcactatccattatattactatgctagttactttactgtacgtgcttcagac
tttgatttaatctcaatgattaaagataaagaaagtatacgtaacacggtaaatgatatg
tattcacgttatatggatttagcaaaaaaagaaaaagatacgttaacggtgcttgagatt
atgaacgagatggcacaacgtggctaccgaatgcaaccaatcagtttagagaagagcaaa
gcatttgaattcataatcgaaggggatactttaattcctccatttattgctgtaccaggt
ttaggtgaaaatgttgcacaaagaattgtagaagcgcgcgatgaagggcctttcttatct
aaagaagatttaaataaaaaagctggtttatctcaaaaagttattgagtatctagatgaa
ttaggttcattacctaatttgccagataaagcacagctttccatttttgatatgtaa

DBGET integrated database retrieval system