KEGG   Staphylococcus saprophyticus: SSP1569Help
Entry
SSP1569           CDS       T00269                                 

Definition
(GenBank) carbamoyl-phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00240  Pyrimidine metabolism
ssp00250  Alanine, aspartate and glutamate metabolism
ssp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSP1569
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSP1569
Enzymes [BR:ssp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     SSP1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATP-grasp_3 Dala_Dala_lig_C ATP-grasp ATPgrasp_Ter GARS_A ATP-grasp_4 ATP-grasp_5 ATP-grasp_2 Intein_splicing
Motif
Other DBs
NCBI-ProteinID: BAE18714
UniProt: Q49WY4
Position
complement(1635763..1638936)
Genome map
AA seq 1057 aa AA seqDB search
MPKRQDIETILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDNEI
ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHDSGELEANNVKLLGTEL
ESIQQAEDRELFRTLMNDLGVPVPESDIVNTVEQAFAFKEEVGYPLIVRPAFTMGGTGGG
ICHNDAEFKEIVTNGLHYSPATQCLIEKSIAGFKEIEYEVMRDKNDNAIVVCNMENIDPV
GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSLDYYIIEVN
PRVSRSSALASKATGYPIAKLAAKIAIGLTLDEMLNPITETSYAAFEPTLDYVISKIPRF
PFDKFEKGERVLGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLPNGETFDLGYI
KERIQDQDDERLFFIGEAIRRGTTLEEIHEMTKIDYFFLNKFQHIIDIEHDLKSNKGDID
YLKFAKNYGFSDRVIAHRFDMTEEEVYDLRQQNGIIPVYKMVDTCAAEFESATPYYYGTY
EYENESVVTEKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQQAGYEAIIVNNNPETVST
DFSISDKLYFEPLTEEDVMNIIDLEQPKGVVVQFGGQTAINLADKLAKHDVKILGTSLED
LNRAEDRKEFEALLHTIDVPQPNGKTATSPQEALENARSIGYPVVVRPSYVLGGRAMEIV
NSDAELEDYMNQAVKASPDHPVLVDRYLTGKEIEVDAISDGETVIIPGIMEHIERAGVHS
GDSIAVYPPQTLKQEEMTTLEDFTIRLAKGLNIVGLINIQFVIAHDGVYVLEVNPRSSRT
VPFLSKITNIQMAQLAMRAIIGDKLVDLGYQPGIQPYTEGVFVKAPVFSFNKLKNVDITL
GPEMKSTGEVMGKDATMEKALFKGLTASGMEVKDHGTVLMTVSDKDKDEIVSIAQRLNEV
GYRILATQGTARKLAENNIPSEVVGKIGGEDDLLTRIQNGEVQIVVNTMTKGKEFERDGF
QIRRASVENGVPCLTSLDTVVALTRVIESMTFTMKNM
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacgtcaagatatagaaaccattttagtaataggatcaggaccaattattatc
ggtcaagctgcagagtttgattatgctggaactcaagcttgtcttgcgttaaaagaagaa
ggataccgcgtcattttagtgaattccaatcctgcaacaattatgacggataacgaaatt
gcagataaagtttatattgagcctttaacacatgacttcatcgcacgtattatacgtaaa
gaacaaccagatgcattattacctacacttggtggccaaactggtttgaatatggcgatt
cagttgcatgatagtggtgaactagaagcgaataatgtaaaactattaggtactgaattg
gaatccattcaacaggcggaagatagagagttatttagaacacttatgaacgatttaggc
gtaccagttcctgaaagtgatatcgttaatacagttgaacaagcttttgcttttaaagaa
gaagtgggttatccactcatcgttagacctgcattcacaatgggtggcacaggtggcggt
atttgtcacaatgatgcagaattcaaagaaattgtaacaaacggtctacattatagtccg
gcaacacaatgtctaattgaaaaatcaattgcaggatttaaagaaatagaatatgaggtt
atgcgtgataaaaacgataacgcaatcgtagtttgtaatatggaaaatattgaccctgtc
ggcatacatacaggtgattcaatcgttgttgcaccaagccaaacactatcagatgtagag
tatcaaatgttacgtgatgtatcattgaaagttattcgagcgctcggtatagaaggtgga
tgtaatgtgcaattagcattagacccacactcattagattattatattattgaagtgaat
ccacgtgtttcaagatcatctgcattagcttcaaaagcaacgggctatccgattgctaaa
ttagcagctaaaatcgctattggtttaacactagatgaaatgttaaatccgataacagaa
acatcctatgcagcatttgagccaactttagattatgtaatttctaaaattcctcgtttc
ccatttgataaattcgaaaaaggagaacgtgtcttaggaactcaaatgaaagcaactggt
gaagtaatggcaattggtagaacatatgaagaatcactactaaaagcaattcgttcctta
gaatatggtgtacatcacttaggattacctaatggtgaaacatttgatttaggttatatt
aaagaacgtattcaagaccaagatgatgaacgtttattctttataggtgaggcaattcgc
agaggtactacattagaagaaatacatgaaatgacaaaaatagattatttcttcttaaat
aaattccaacacatcatagatattgaacacgatttgaaatcaaataaaggtgacattgat
tatttaaaattcgcaaaaaattacggttttagtgatagagtaatcgcacatcgattcgat
atgacagaagaagaggtgtacgatttaagacaacaaaacggcattataccagtgtataaa
atggttgatacatgtgctgcagaatttgaatctgctacgccttattattacggcacgtat
gaatatgaaaatgaatctgtagtcacagagaaagaaaaaattcttgtcttaggttcagga
cctattagaattggacaaggtgtagaatttgattacgccactgtacatgctgtatgggca
attcaacaagcgggctacgaagcgattatagttaataacaatccagaaactgtttcgacc
gacttttctatttcggataaattatactttgaaccgttaactgaagaagatgtcatgaac
attatagatttagagcaacctaaaggtgtcgttgtacagtttggtgggcaaacggccatt
aacttagccgataaactagcgaaacatgacgtgaagattttaggaacatcattagaagat
ttaaatagagcagaagaccgtaaagagtttgaagcgttattacacacgattgatgtacca
caacctaatggtaaaactgcaacgtcaccacaagaagcattagaaaatgcacgcagtatt
ggctatccagtcgtcgtcagaccttcttatgtattaggtggtcgcgctatggaaatcgtt
aatagtgatgcagaattagaagactacatgaatcaagcagttaaagcaagtccagaccat
ccggtattagtcgatagatatttgacaggtaaagagattgaagtagatgcgatttctgat
ggtgaaacagtgattataccaggtattatggaacatattgaaagagcgggagtccattca
ggtgattccattgctgtttatccaccacaaacgttaaagcaagaagaaatgacaacatta
gaagactttacgattcgtttagcaaaaggcttaaacattgttggtttaattaacattcaa
tttgtaattgcgcatgatggtgtatatgtattagaagtgaatccacgttcgagtcgtaca
gtaccatttttaagcaagattacgaatattcaaatggcacagttagctatgcgtgcaatc
ataggtgacaagctagtggacttaggatatcaaccaggcatccaaccttatacagaaggt
gtctttgtgaaagcacccgtatttagctttaacaaattgaaaaacgtcgacatcacgtta
ggacctgaaatgaagtcaacaggtgaagtgatgggtaaagatgcaactatggaaaaagca
ctgtttaaaggtttaacagctagtgggatggaagttaaagatcatggtacggtcttgatg
acagtcagcgataaagataaagatgaaattgtctctattgcacaacgattaaatgaagta
ggatatagaatcttagcaacacaaggtactgcacgaaaattagccgagaataatatacct
tcagaagtagtaggaaaaattggtggcgaagatgatttacttacgcgtatacaaaatgga
gaagtacaaatcgttgtgaatacgatgaccaaaggtaaagaattcgaacgagatggtttc
caaattagacgcgcctccgtagaaaatggcgtgccttgtctaacctcattagatacggtt
gttgcattaacacgtgtaattgaaagcatgacatttacaatgaaaaatatgtag

DBGET integrated database retrieval system