KEGG   Staphylococcus saprophyticus: SSP1694Help
Entry
SSP1694           CDS       T00269                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase component of pyruvate dehydrogenase complex E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00020  Citrate cycle (TCA cycle)
ssp00620  Pyruvate metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
Module
ssp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP1694
   00020 Citrate cycle (TCA cycle)
    SSP1694
   00620 Pyruvate metabolism
    SSP1694
Enzymes [BR:ssp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSP1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 ATP-synt_ab_Xtn Lin-8
Motif
Other DBs
NCBI-ProteinID: BAE18839
UniProt: Q49WM0
Position
complement(1761672..1762973)
Genome map
AA seq 433 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTIEEVL
VDEGTVAVVGDTIVKIDAPDAEDMQFKGSESDEASSESTEAPVEESTKEEASAPAQSSND
EEVDESKRVKAMPSVRKYARENGVNIKAVSGSGKNGRTTKEDVDAYLNGGQATASNESAV
ATSEETTSSAQSAAVSTEGEYPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQEL
WDHRKKFKEVAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIA
ADTDRGLLVPVVKNADRKSMFAISDEINELAVKARDGKLSADEMKGATCTISNIGSAGGQ
WFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLSLSLSFDHRQIDGATGQNAMNHIK
RLLNNPELLLMEG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaattacccgacattggtgaaggtatccacgaaggtgaaattgta
aagtggtttgttaaagctggagatacaattgaagaagatgatgtattagctgaagttcaa
aacgacaaatcagttgttgaaattccatcacctgtttcaggtactatcgaagaagtatta
gtagatgaaggtactgtagcagttgttggtgatacaattgttaaaattgatgcacctgat
gcagaagacatgcaatttaaaggtagcgaaagtgacgaggcttcaagcgagtcaacagaa
gctcctgttgaagaaagcactaaagaagaagcatcagcacctgctcaatcttcaaatgat
gaagaagtagatgaaagtaaacgtgttaaagcaatgccgtcagttcgtaaatacgcacgt
gaaaatggtgttaacattaaagctgtttcaggttcaggtaaaaacggacgtacgactaaa
gaagacgttgatgcttacttaaatggtggacaagcaacagcttcaaatgaaagtgcagta
gcaactagcgaagaaactacaagttctgcacaatcagcagcagtttctacagaaggggaa
tacccagaaactactgaaaaaatacctgcaatgcgtaaagcaattgctaaagcaatggtt
aactcaaaacatactgcacctcacgtaacattgatggatgaaattgatgtgcaagaatta
tgggatcaccgtaaaaaattcaaagaagttgcagctgaacaaggtactaaattaactttc
ttaccttacgttgtcaaagcacttgtgtctgcacttaaaaaatacccagcacttaatact
tcatttaatgaagaagctggtgaaatcgtgcataaacattactggaatatcggtattgca
gctgacactgacagaggtttactcgtaccagtagttaaaaatgctgatcgcaaatctatg
tttgcaatttcagacgaaattaatgaacttgctgtcaaagcacgtgatggtaaattatca
gctgatgaaatgaaaggtgctacttgtacaattagtaacatcggttcagcaggtggacaa
tggttcacaccagttatcaatcacccagaagttgctatcttaggtattggtcgtattgcg
caaaaacctatcgtaaaagatggagaaattgttgcggcaccagtattatcattatcacta
agctttgaccatagacaaattgatggtgcaactggtcaaaacgctatgaatcatattaaa
cgtttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system