KEGG   Staphylococcus saprophyticus: SSP2059Help
Entry
SSP2059           CDS       T00269                                 

Definition
(GenBank) putative phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ssp  Staphylococcus saprophyticus
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SSP2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAE19204
UniProt: Q49VK6
Position
complement(2125789..2126796)
Genome map
AA seq 335 aa AA seqDB search
MEYILIITVAIVIFSLIFDFINGFHDTANAVATAVSTRALTPRTAILLASVMNFIGALTF
TGVAGTITKDIVDPFKLENGLIVVLAAIIAAILWNLITWYYGIPSSSSHALIGSIAGAAI
ASQGSFAVLHYEGFTKIIVVLLVSPIIAFCVGFIMYSIVKVVFKNANLTKSNRNFRFFQI
FTASLQSFSHGTNDAQKSMGIITLALIVANIQTGTSVEPQLWVKVACATAMGLGTAVGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGSSNRIKG
VKWNTAQRMIITWVITLPISALVAAIIYYIINIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaatatattttgatcatcacagtagctatcgttattttttcacttatatttgacttt
atcaatggtttccatgatacagccaatgctgttgctactgctgtttctactcgtgcctta
acgcctagaactgcgatacttttagcatcagtgatgaattttattggtgctttaactttc
actggggttgcagggacaattacgaaagatattgtagacccatttaaattagaaaatggt
cttattgtcgtattagcagccattatcgcagctattttatggaatttaatcacatggtat
tatggtataccaagttcgtcatcacacgcattaattggttctattgctggcgcagcaatt
gcttcgcaaggttcatttgcagtattacattatgaaggattcacgaaaatcatcgttgtt
ttacttgtatcaccgattattgcattttgtgttggttttatcatgtattcaatcgtaaaa
gttgtatttaaaaatgcaaatcttacaaagtctaatcgtaactttagatttttccaaatt
ttcacagcatcactacaatcattttctcatggtacaaatgatgcgcaaaaatcaatgggg
attattacattggctttaatagttgctaatattcaaacaggtacaagcgttgaaccgcaa
ttatgggttaaagttgcctgtgctactgcaatgggactaggtacagctgttggtggttgg
aaaattatcaaaacagttggtggtaatattatgaaaatacgtccagctaatggtgcagct
gcagatttatcatctgcattaacaatatttgttgcatcatcattacatttcccattatcc
acaacacatgttgtatcttcatctattctaggtgttggttcatctaaccgtattaaaggt
gtgaaatggaatacagcacaacgtatgattatcacatgggtaattacattaccaatttct
gcacttgttgcagcaattatttactacattataaatattttcttatag

DBGET integrated database retrieval system