KEGG   Staphylococcus saprophyticus: SSP2145Help
Entry
SSP2145           CDS       T00269                                 

Definition
(GenBank) putative acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00071  Fatty acid degradation
ssp00072  Synthesis and degradation of ketone bodies
ssp00280  Valine, leucine and isoleucine degradation
ssp00310  Lysine degradation
ssp00362  Benzoate degradation
ssp00380  Tryptophan metabolism
ssp00620  Pyruvate metabolism
ssp00630  Glyoxylate and dicarboxylate metabolism
ssp00640  Propanoate metabolism
ssp00650  Butanoate metabolism
ssp00900  Terpenoid backbone biosynthesis
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
ssp01212  Fatty acid metabolism
ssp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSP2145
   00630 Glyoxylate and dicarboxylate metabolism
    SSP2145
   00640 Propanoate metabolism
    SSP2145
   00650 Butanoate metabolism
    SSP2145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSP2145
   00072 Synthesis and degradation of ketone bodies
    SSP2145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSP2145
   00310 Lysine degradation
    SSP2145
   00380 Tryptophan metabolism
    SSP2145
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSP2145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSP2145
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSP2145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssp04147]
    SSP2145
Enzymes [BR:ssp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSP2145
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSP2145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAE19290
UniProt: Q49VC0
Position
complement(2207340..2208482)
Genome map
AA seq 380 aa AA seqDB search
MTEVVIVAAKRTAFGKYGGSLKHLEPEALLKPLFRHLTETYSEAMAHIDDVILGNVVGNG
GNIARKALLEAGLSEHIPGLTIDRQCGSGLEAVIHACRMIQAGAGHIYIAGGVESTSRAP
WKIKRPQSVYDTHLPEFFERASFAPDGQDPSMIEAAENVAKTYGITREEQDQYALNSHKK
TIEAYENNIVQQEIINLSAKGEIFNRDDSIKERLNVRTLSRLNPLLSEGTVTAGNCCMKN
DGAVLLMIMDKKTALAHKFKEGLIFKDSITIGVEPTLLGMGPVPAVSKLLRKNKMTIEDI
NAIELNEAFASQVVASQRCLDIPAHKLNKYGGAIATGHPYGASGAALVTRLFHMKNDKRT
IATMGIGGGMGNAALFERWL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagttgttattgtggctgcgaaacgtacggcatttggtaaatatggcggttca
ttaaaacatttggaacctgaagcattattaaaaccattatttcgtcatttaactgaaacc
tattcagaagcgatggctcatattgatgatgtaatccttggaaatgtagtaggtaatggt
ggaaatattgctagaaaagctttgcttgaagcagggttaagtgaacatataccaggttta
acgatagatagacagtgtggttcaggattagaagcggtcattcatgcatgtagaatgata
caagcgggtgcaggtcatatttatattgcaggtggtgtagaaagtacgagtagagcacca
tggaaaattaaaaggccacaatcggtttatgatacacatttaccggaattctttgaacgt
gcttcgtttgcaccagatggacaagacccatcaatgattgaagcagcagaaaatgttgct
aaaacctatggaattacaagagaagaacaagatcaatacgctttaaatagtcataaaaaa
acaatagaagcctatgaaaacaatatcgttcaacaagaaattataaatttaagtgctaaa
ggtgaaatatttaatagagatgatagcatcaaagaaagattaaacgtacgcacattaagt
cgcttaaaccctttattgtcagaggggacagttactgctggaaattgttgtatgaaaaat
gatggggcagtattacttatgattatggataaaaaaactgctttagcacataaatttaag
gaaggcttaatatttaaagatagcattacaataggtgtagaaccgacattgctgggtatg
ggtccagtacctgcagtttctaagttacttcgcaaaaacaagatgacgatagaagacatc
aacgcaatagaattaaatgaagcattcgcgtctcaagtagtagccagtcaaagatgtttg
gatattccagcacataagttgaacaaatatggtggtgctattgctactggtcatccgtat
ggtgcaagtggggctgcacttgtaactcgcttatttcacatgaaaaatgataaacgtact
attgcaacaatgggtattggaggaggaatgggcaatgcagccttatttgaaagatggtta
tga

DBGET integrated database retrieval system