KEGG   Staphylococcus saprophyticus: SSP2266Help
Entry
SSP2266           CDS       T00269                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00450  Selenocompound metabolism
ssp00970  Aminoacyl-tRNA biosynthesis
ssp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SSP2266
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSP2266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssp01007]
    SSP2266
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssp03016]
    SSP2266
Enzymes [BR:ssp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SSP2266
Amino acid related enzymes [BR:ssp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SSP2266
Transfer RNA biogenesis [BR:ssp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SSP2266
 Prokaryotic type
   Other AARSs
    SSP2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f T4_neck-protein PilM
Motif
Other DBs
NCBI-ProteinID: BAE19411
UniProt: Q49UZ9
Position
complement(2341090..2343066)
Genome map
AA seq 658 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYTTTAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKSEIEYLDEMIAGIKDLWGKLEISNDDFIRTTEIRHKEVVQQIFERLLAQGDIYL
GEYEGWYSVPDETYYTETQLVDPIMENGVIVGGKSPDSGHEVELVKEESYFFNLSKYTDR
LLEFYDENPEFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGIRVQSNPKHVVYVWIDA
LVNYISSLGYLSDDDSLFKKYWPADIHIMAKEIVRFHSIIWPILLMALDIPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNVLINRYGLDATRYYLMRELPFGSDGVFTPEGFVERTNYDL
ANDLGNLVNRTISMVNKYFDGELPAYQGPKHELDKDMEQMALDTVKTFHENMDDLQFSVA
LSTIWKFISRTNKYIDETSPWVLAKDEDQKEMLGNVMAHLVENIRIIAVLLRPFLTHAPK
QIFSQLNINAPELFELESIEQYGALTEPIMVSGKPEPIFPRLDSEVEISYIKESMQPDKI
EEEVEEELPSKAQIDIKDFDKVEIKAATIIDAEQVKKSDKLLKIQVDLDSEQRQIVSGIA
KFYQPEDIIGKKVAVVTNLKPAKLMGRKSEGMILSAEKDGVLTLVSLPSAIPNGAIIK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaacattttatatcactacaccaatatattatccaagtgggaatttacat
atcggtcatgcttatacgacaacagctggtgatgtaatcgcacgttataaaagaatgcaa
ggctatgatgttcgttatttaacgggaacggatgaacatggacaaaaaattcaagaaaaa
gcacaaaaagctgggaaatcagaaatcgagtaccttgatgaaatgattgctggtattaaa
gatttatggggaaaactagagatttcaaacgacgattttatacgtacaacagaaattaga
cataaagaagttgtacaacaaatatttgaacgtttattggctcagggagatatttatctt
ggtgaatatgaaggttggtattctgttccggatgaaacgtattatactgaaacacaatta
gtcgatccaattatggaaaacggagtgattgttggaggtaagagtcctgattctggtcat
gaagtagaattagtaaaagaggaaagttatttcttcaatttatctaaatatacagaccgt
ttattagaattttatgatgaaaatcctgaatttattcaaccgccttcacgtaaaaatgaa
atgattaataatttcattaaaccaggacttgaagatttggcagtatcaagaacatcattt
gattggggtattcgtgttcaatcaaatcctaagcatgttgtttatgtttggatagatgcg
cttgtaaattatatttcttcattaggttatctatcagatgatgacagtctattcaagaaa
tattggcctgcagacattcatattatggctaaggaaattgtacgattccactctattata
tggccgattttattaatggcactagacattccattacctaaaaaagttttcgcacatggt
tggatacttatgaaagatgggaaaatgagtaaatctaaaggtaatgttgtagatcctaac
gtattgattaatcgttacggtttggacgcaacacgttactacttaatgcgtgaattacca
tttggctctgacggtgtatttacaccagaaggatttgtagaacgtacaaattatgactta
gcaaatgacttgggtaacttagttaatcgaacaatttcaatggtgaacaaatattttgat
ggtgaactaccagcatatcaaggtcctaaacacgaattagataaagatatggaacaaatg
gcactagataccgtcaaaactttccatgaaaatatggacgacttacaattctcagtagca
ctttcaactatatggaaattcattagtcgtactaataaatatatcgatgaaacgtcacca
tgggttttagctaaagatgaggatcaaaaagaaatgcttggtaacgtaatggcacactta
gtagaaaatattcgtattattgcggtattattaagaccattccttacacatgcaccaaaa
caaatcttcagccaattaaatattaatgcaccagaactttttgaattagaaagtattgaa
cagtatggcgcattaactgaaccgattatggtgagtggtaaacccgaaccaatcttccca
cgtttggatagcgaggttgaaattagctatatcaaggaatcaatgcaaccagacaagatt
gaagaagaagttgaggaagagttgcctagcaaagcgcaaattgatatcaaagattttgat
aaagtagaaatcaaggctgcaacaattattgacgccgagcaagtgaaaaaatctgataag
ttattaaaaattcaagttgatttggatagtgaacaacgtcaaatcgtttcaggtattgca
aaattctatcaacctgaagatattattggcaaaaaggtagcagttgtcactaatttaaaa
ccagctaaattaatgggtagaaaatcagaaggtatgatactttctgctgaaaaagatggt
gtacttacacttgtaagcttgcctagtgcaattccaaatggtgcaataattaaataa

DBGET integrated database retrieval system