KEGG   Streptococcus suis D9 (serotype 7): SSUD9_0307Help
Entry
SSUD9_0307        CDS       T02022                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00260  Glycine, serine and threonine metabolism
ssq00750  Vitamin B6 metabolism
ssq01100  Metabolic pathways
ssq01110  Biosynthesis of secondary metabolites
ssq01120  Microbial metabolism in diverse environments
ssq01230  Biosynthesis of amino acids
Module
ssq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUD9_0307
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSUD9_0307
Enzymes [BR:ssq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSUD9_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N Ferritin
Motif
Other DBs
NCBI-ProteinID: AER16563
Position
288676..290106
Genome map
AA seq 476 aa AA seqDB search
MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPISIPAVDLDFSVLKDASYQEVAKLIL
SAFLDDFTADELDYCINNAYDSKFDTPAIAPVVKLKGQYNLELFRGSTIAFKDMALSILP
YLMTTAAKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKRMFNDEALRAKLAAKKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNNVLTD
FFSTGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFDNDAAKTAELMEALNTAGQYDIQ
GADADILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQTPTV
IASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVALPPAVDGLETAICRLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcggctagtcaggcg
atattgcagggcttggcgaccgacggtggtttgtttacaccgatttctattccagcagtt
gacttggacttttctgttctcaaagacgcttcttatcaagaagttgccaagttgattttg
tcggctttcttggacgattttacggcagatgagttggactactgtatcaacaatgcctac
gatagcaagtttgacacaccagctattgccccagtggttaagctaaaaggtcagtacaat
ttggaactcttccgaggttcaaccattgcctttaaggatatggctctgtccatcctccct
tacttgatgacgactgcggcgaaaaagcatggtttggaaaatgagattgtcattttgacc
gcgacttcaggcgatacaggtaaggcagctatggctggttttgcagacgttcctggcacg
caaatcattgtcttctacccacgtgacggggtatctaaggtccaagaattgcagatgact
acgcagacaggggctaatacgcacgtggtggccattgacggtaactttgacgacgcccag
acaaatgtcaaacgtatgttcaacgatgaggctctccgtgccaagttggcagcgaagaaa
cttcagttttcatctgccaattctatgaacatcggccgcttggtgccacagattgtttac
tatgtctatgcctacgctcagctggttaagactggcgagattgcggcgggcgacaaggtc
aacttcaccgttccaacaggaaactttggaaacatcttggcggcttattacgccaaacaa
atcggtctgccagttggcaagctcatctgtgcttccaacgacaacaatgtcctaaccgac
ttcttctcgactggcgtttacgacaagaaccgtaccttccgcgtgaccaccagtccgtcc
atggacatcttggtgtcttctaacttggagcgcttgattttccatctctttgacaatgac
gctgcaaaaacagcggagctgatggaagccttgaacacagctggtcagtatgatattcaa
ggggctgacgcggatatcctctctctctttgctgccgcctttgcgacggaagaagaaacg
gctgcggaaatcaagcgagtctatgacgagtcagactacattgaagacccacatacggct
gttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaaactccgactgtg
attgcttctacagcaagtccttacaagttcccagtagttgcggttgaggctgtgacaggc
cagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatttcaggtgtagct
ttgccaccagctgtggacggcttggaaacggcgatatgcaggctgaagtag

DBGET integrated database retrieval system