KEGG   Streptococcus suis D9 (serotype 7): SSUD9_0636Help
Entry
SSUD9_0636        CDS       T02022                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSUD9_0636 (recR)
DNA repair and recombination proteins [BR:ssq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SSUD9_0636 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SSUD9_0636 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: AER16867
Position
625585..626181
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFAKNLLAAKRDLSYCSIC
GNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHGLYHVLHGLISPMNGIGPD
DINLKTLLTRLMDNEVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccctacacctattgccaagttaattgatagctattctaaattgccaggtatc
ggtataaaaacggctacccgtttagctttttatactattggcatggaggatgatgtcgtt
aatgagtttgcaaaaaatttattggcagccaagcgagacctatcttattgctctatttgt
ggtaatttgacagatcaggacccctgtgctatttgccaggactcaacgcgagaccaatct
actattttgattgtagaggatagtcgagatgttacagccttggaaaatattcaagaatac
cacggtctttatcatgtcttgcatggcttgatttctcccatgaatggtattggaccagat
gatattaatttgaaaaccctcctcactcgcctgatggacaatgaggttacagaagttatt
gtggcgaccaatgcaacagcagatggagaagctacatctatgtatatctcacgtgtcctc
aaacctgcgggaatcaaagtaacccgactagctcgtggcttagcggtaggcagtgatatt
gaatatgcagatgaagtgaccctgttgagggctattgaaaaccgcacagagctatag

DBGET integrated database retrieval system