KEGG   Streptococcus suis D9 (serotype 7): SSUD9_0814Help
Entry
SSUD9_0814        CDS       T02022                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00480  Glutathione metabolism
ssq00590  Arachidonic acid metabolism
ssq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SSUD9_0814
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SSUD9_0814
Enzymes [BR:ssq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSUD9_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AER17037
Position
819702..820181
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYRGQGFVVLD
FPCNQFLNQAPGSAEDINQTCSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggaacagatcagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctatcgaggccaaggttttgtagtgttggat
ttcccttgcaatcaatttttaaatcaggctcccggttctgctgaagacatcaatcagacc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system