KEGG   Streptococcus suis D9 (serotype 7): SSUD9_0935Help
Entry
SSUD9_0935        CDS       T02022                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Brite
KEGG Orthology (KO) [BR:ssq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ssq03009]
    SSUD9_0935
Enzymes [BR:ssq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SSUD9_0935
Ribosome biogenesis [BR:ssq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SSUD9_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AER17142
Position
939660..940553
Genome map
AA seq 297 aa AA seqDB search
MEVRVEVGGIRLDKALSDLTDLSRSVANEQIKAGQVLVNGQPKKAKYSVQVGDVLTYQIP
EVEEIDYVAEDIPLEIVFQDEDVAVVNKPQGMVVHPSAGHTSGTLVNALLYHVKDLSGIN
GVLRPGIVHRIDKDTSGLLMIAKNDDAHTKLAAELKDKKSLRKYWAIVHGNLPNDRGVIE
APIGRSEKDRKKQAVTAKGKEAVTRFQVLERFGDYTLVELTLETGRTHQIRVHMAYIGHP
VAGDEAYGPRKTLKGHGQFLHARTLGFTHPRTGEVVEFTAEAPAIFQEALEKLRKAE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaagagttgaggttggtggtattcgtttggataaggcattgtcggatttgacg
gatttgtctcgttcggttgcaaatgagcagattaaggctggtcaggttttggtcaatgga
cagcctaaaaaagctaaatatagtgtgcaggttggggatgtcctaacctatcaaattcca
gaagtagaagaaatcgactatgttgctgaggatattcctttagagattgtctttcaggac
gaggatgttgctgttgtaaataaaccacaagggatggtcgttcatccgtcggctggtcac
acgtctgggacgctagttaatgctctcctttatcacgtaaaagatttgtcaggcatcaat
ggtgtcttgcgaccaggtattgtccatcggattgacaaggacacatctggcttgctcatg
attgctaaaaacgatgatgcccatacaaagcttgctgctgaattgaaagataagaaatcc
cttcgtaagtattgggccattgtacacggcaatctaccaaacgatcgcggagtaattgag
gcgccgattggtcgttctgaaaaagaccgcaagaaacaagcggtgactgccaaagggaaa
gaagcggtgacacgttttcaggttttggagcgttttggtgactacactttggtggaattg
accttggaaacaggacgaactcaccaaattcgtgtccacatggcttatattggtcatccg
gttgcgggtgatgaagcttacggcccaaggaaaacactaaaagggcatggccaatttctt
catgccagaacgcttggatttacccatccgagaactggtgaggttgttgaatttacggca
gaagcgccagctatttttcaggaggcacttgaaaaactgcgcaaggctgaataa

DBGET integrated database retrieval system