KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1416Help
Entry
SSUD9_1416        CDS       T02022                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00520  Amino sugar and nucleotide sugar metabolism
ssq01100  Metabolic pathways
ssq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD9_1416
Enzymes [BR:ssq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SSUD9_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AER17600
Position
complement(1404787..1405932)
Genome map
AA seq 381 aa AA seqDB search
MTVFIKAKSIILPESEVESAYLEITDKGQFGRIVTEKPEGEIVDYSDFHLAPGLVDTHIH
GYASHDVMDNDFEGIKVISEGLLSCGVTSWLPTTLTDTTENLDAVCETIGTYAGQETGAK
IQGIFLEGPFFIEKYKGAQNPKYMSDPSIEKLDNWHSLSKGLVNKIAIAPEREGVKEFIE
FANSKAIHTALAHSDATYTQAEAAVEAGANIFVHVYNGMSGLHHREPGMVGAALNLKNVY
AEMICDGHHVHPAAAEIVVKARGAEETVLITDCMRAGGMGEGESRLGEFEVVVKDGTARL
KESGSLAGSILELIEAVQNVVKWGLVSLPDALRMASLAPARSVNIDHICGRIAEGRAADF
IVVDDAGRLQATYLDGVKRFG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacagtatttataaaagcaaaatctattattttaccagagagtgaggtcgaatcagcc
tatttggaaattactgacaagggtcagtttggacggattgtgactgaaaagcctgaaggg
gagattgttgattattctgactttcatttagcaccagggctagttgatacacatatccac
ggctacgcttctcacgatgttatggacaatgattttgaagggatcaaggtaatttcagaa
ggtctcttgtcttgtggggtaacctcttggcttccaacgacattaacggatacgactgaa
aatttagatgcagtttgtgaaacgattgggacttatgcagggcaggaaacaggcgccaag
attcaaggtattttcttagaaggtcccttctttatagaaaaatacaagggagcacaaaat
cctaagtacatgagcgatccatccattgaaaagttggacaactggcacagcttatctaaa
ggtttagtcaataaaattgctattgctccagaacgtgaaggcgtcaaagaattcatcgag
tttgctaacagcaaggcaattcatactgccttggctcacagcgatgcgacctatacgcaa
gcggaagcggcagtagaagctggtgccaatatcttcgtccatgtttacaatgggatgagt
gggcttcatcaccgtgaaccaggtatggtcggtgctgctttgaatttaaaaaatgtctat
gcggaaatgatttgtgatggacaccacgttcatccagctgcggcagaaatcgtggtcaaa
gcacgtggagctgaggaaactgttttgattacggactgtatgcgagctggcggtatgggt
gaaggggagtcccgcctcggtgaatttgaagttgttgtaaaagatggaactgctcgttta
aaagaaagtggtagtttggcaggttctatcttagaattgattgaagcagtgcagaatgtt
gtgaaatggggcttggtgtccctacctgatgcccttcgtatggcttctctggcaccagct
cgctctgtcaatattgaccatatttgtggtcggattgcagaaggccgagctgcagacttt
atcgtcgtagatgatgcaggacgcttacaagcgacctatctagatggcgtgaaacgattt
ggttaa

DBGET integrated database retrieval system