KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1543Help
Entry
SSUD9_1543        CDS       T02022                                 

Definition
(GenBank) glycosidase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSUD9_1543
Enzymes [BR:ssq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SSUD9_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1964
Motif
Other DBs
NCBI-ProteinID: AER17727
Position
complement(1534088..1535536)
Genome map
AA seq 482 aa AA seqDB search
MKIKNQAMLITYSDSLGKNLKDLKKVLEGPLKDVVGGIHILPFFPSSGDRGFAPMDYTKV
DPAFGDWSDIEALSKDYYLMFDFMINHISAKSPYFLDFLEKKDQSAYADLFIRYKNFWPN
GEPTQEDVDLIYKRKPRAPYRIATFADGSEEKVWCTFDEQQIDLDVTTETTRQFIQENLE
QLAEHGASIIRLDAFAYANKKIGTNCFFVEPDIWEMLHFPRQLLAPKDVEILPEIHEHYT
IQQKIAEQDYYVYDFALPMLVLHALYSGHVNRLVHWMEICPRKQFTTLDTHDGIGVVDVK
DLLTDEETEETREALYAQGANVKKIYSTEAYNNLDIYQINCTYYSALGNNDQAYLLARVL
QCFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLEEIEQEVQRPVVQSLFKLL
KFRNTSPAFDGEFSVKMLDETSMEIFWNNQDAGVSARLTANLKEKSFEIVEIEEGKITTI
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaaccaagctatgttgattacctattctgatagtttaggcaagaatctc
aaggatttgaaaaaagttcttgagggaccattaaaggatgttgtgggaggtattcacatt
ctaccattcttcccatcatcaggtgaccgtgggtttgcgccaatggattatacaaaggta
gatcctgcatttggagactggtcagatattgaagcattgagtaaggactactatctgatg
ttcgattttatgatcaatcatatatcagcaaaatctccttatttccttgattttcttgaa
aagaaagaccaatcagcttatgcggatttgtttattcgttataaaaacttttggccaaat
ggtgagccaacgcaagaagatgttgatttgatctataagcgtaaacctcgtgctccatat
cgaattgcaacatttgctgatggtagcgaagagaaggtatggtgtacctttgatgaacag
cagattgacttggatgtgactacagagacaacacgccagttcatccaagaaaatctggaa
cagttggcagaacatggtgcttcgatcattcgtttggacgcctttgcttatgccaataaa
aaaataggaaccaattgtttctttgtggaacctgatatttgggaaatgctccattttcca
cgtcagttattggcaccaaaagatgtagaaatcttaccagaaattcatgaacactatacc
attcagcagaaaattgccgagcaagattattatgtttatgattttgccttgccaatgctg
gttctccacgctttgtattctggtcatgtcaatcgcctggtgcactggatggagatttgc
cctcgcaagcaatttacaactcttgatacacatgatggaatcggtgttgtggatgttaag
gatttgctgacggatgaagagacagaggagacacgtgaagccttgtatgcacaaggtgcc
aatgtgaagaaaatttatagtacagaagcctataataatttggatatttatcagattaac
tgtacttattattctgctcttggcaataatgatcaagcttatctattggcgcgtgttctc
caatgctttgcaccaggtattccacagatttattatgttggtttactagcaggcgaaaat
gatattgaacttttagaatcaagtaaggaagggcgcaatatcaatcgccattactatgat
ttggaagaaattgagcaggaagtgcaacggccagttgtacaatccttgttcaaactcctt
aaattccgcaatacaagtccagctttcgacggggagttctctgttaagatgttggatgaa
acaagtatggaaattttctggaataatcaagatgcaggggtatctgcccgcctaacagca
aacctaaaagaaaaatcctttgaaattgttgaaattgaagagggaaaaattaccacaatt
gagttataa

DBGET integrated database retrieval system