KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1627Help
Entry
SSUD9_1627        CDS       T02022                                 

Gene name
murZ
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00520  Amino sugar and nucleotide sugar metabolism
ssq00550  Peptidoglycan biosynthesis
ssq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSUD9_1627 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUD9_1627 (murZ)
Enzymes [BR:ssq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SSUD9_1627 (murZ)
Peptidoglycan biosynthesis and degradation proteins [BR:ssq01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SSUD9_1627 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AER17803
Position
complement(1609317..1610576)
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGKTLKGSVTVSGAKNSVVALIPAIILADGIVTLDGVPAISDVDSLVDIMETM
GAMVKRDGETLEIDPRGVKDMPMPFGKINSLRASYYFYGSLLGRFGQAVVGLPGGCDLGP
RPIDLHLKAFAAMGAETTYEGDYMRLATNGQRIQGAHIFMDVVSVGATINTILAAVKAEG
RTVIENAAREPEIIDVATLLNNMGARIRGAGTDIITIEGVDSLKGTRHQVIPDRIEAGTY
IALAAAVGEGIRIDNVLYEHLESYIAKLEEMGVRMTISEDSIFVEKQEKLKAVSVKTSPY
PGFATDLQQPITPLLLKAEGTGTIVDTIYEKRVGHVQELANLGAKISTRNNHIAFEGPNQ
LTGTSVKATDLRAGAAMVIAGLMAQGRTEITNIEFILRGYSNIIDKLTELGADIQLIED
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgtaattaatggtggaaaaacactgaaagggtcggttaccgttagtggt
gcaaaaaactcagttgttgctcttattccggccattattcttgcagacgggattgttact
ctggacggagtacctgcaatctcggatgtagatagcttagttgatattatggaaacaatg
ggcgcgatggtcaagcgtgatggtgaaaccttggagattgaccctcgtggtgtaaaagac
atgcctatgccatttggcaaaattaatagcttgcgtgcatcctactatttttacggttcc
ctccttggtcgctttggtcaagctgttgttggcttgccaggtggttgtgatttgggaccg
cgtccgattgatttgcacttgaaagcattcgcggcaatgggagctgagacaacttatgaa
ggtgactatatgcgcttggcaactaatggtcagcgtattcaaggggcccatatcttcatg
gatgttgtcagcgtcggtgcgacaattaatactatcttagcagctgtcaaagcagaaggc
cgtacagttattgaaaatgcggcgcgtgagcctgaaattattgatgtggcaacgttgctt
aataatatgggggcacgtatccgtggtgcgggtacagatattatcaccattgaaggcgta
gacagtctaaaaggaacacgtcatcaagtgattccagaccgtattgaagcagggacttat
attgcccttgctgctgctgttggtgaaggtattcgtatcgataatgtcctttatgaacac
ttagagagttacatcgctaagttggaagaaatgggtgttcgcatgaccatttctgaagat
agtatttttgttgaaaagcaagagaaattgaaggcggtaagtgtgaaaacttcaccttat
ccaggttttgcgacagacttgcagcaacccattacacctttattgcttaaggcagaaggg
actggtacgattgttgatacgatttatgaaaaacgtgttggtcatgtgcaggagcttgct
aatcttggagcaaaaatctctactcgtaacaaccatattgcctttgaaggtccaaatcaa
ctgactggtacatctgttaaagctaccgatttgcgtgcgggagccgcaatggttattgct
ggtttaatggctcaagggcgtacagaaattacaaatattgagtttattctacgtggttac
tcaaatattattgataaactgacagaattgggtgcagatattcagttgattgaggattag

DBGET integrated database retrieval system