KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1649Help
Entry
SSUD9_1649        CDS       T02022                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00071  Fatty acid degradation
ssq00072  Synthesis and degradation of ketone bodies
ssq00280  Valine, leucine and isoleucine degradation
ssq00362  Benzoate degradation
ssq00380  Tryptophan metabolism
ssq00620  Pyruvate metabolism
ssq00630  Glyoxylate and dicarboxylate metabolism
ssq00640  Propanoate metabolism
ssq00650  Butanoate metabolism
ssq00900  Terpenoid backbone biosynthesis
ssq01100  Metabolic pathways
ssq01110  Biosynthesis of secondary metabolites
ssq01120  Microbial metabolism in diverse environments
ssq01130  Biosynthesis of antibiotics
ssq01200  Carbon metabolism
ssq01212  Fatty acid metabolism
ssq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUD9_1649 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSUD9_1649 (atoB)
   00640 Propanoate metabolism
    SSUD9_1649 (atoB)
   00650 Butanoate metabolism
    SSUD9_1649 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSUD9_1649 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSUD9_1649 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUD9_1649 (atoB)
   00310 Lysine degradation
    SSUD9_1649 (atoB)
   00380 Tryptophan metabolism
    SSUD9_1649 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUD9_1649 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUD9_1649 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSUD9_1649 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssq04147]
    SSUD9_1649 (atoB)
Enzymes [BR:ssq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUD9_1649 (atoB)
Exosome [BR:ssq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUD9_1649 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AER17823
Position
1629109..1630293
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALANKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHISLEDSMLTDGLTDAFNDYHMGITAENVAERYHVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKEGTV
TAANASGINDGCAVLVLMSDEKASELNIQPLAYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctaat
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctagctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagccggtttggtagtaaatttggtcatattagtctggaa
gattccatgttaacagatggtttgacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacgctatcatgtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcaaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggaaggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttggtactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcctgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagcattcgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatagcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaaattaa

DBGET integrated database retrieval system