KEGG   Streptococcus suis D9 (serotype 7): SSUD9_1843Help
Entry
SSUD9_1843        CDS       T02022                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssq  Streptococcus suis D9 (serotype 7)
Pathway
ssq00010  Glycolysis / Gluconeogenesis
ssq00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD9_1843
   00500 Starch and sucrose metabolism
    SSUD9_1843
Enzymes [BR:ssq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSUD9_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AER18011
Position
complement(1815318..1816784)
Genome map
AA seq 488 aa AA seqDB search
MTKQFPKGFLWGGATAANQYEGGWNLGGRGPATSDTYIAVDPDKRKDMSHFGKPVSRADV
EFALADQEGLYPKRWGSDFYHRYKEDIALFAEMGFKTFRLSIAWSRIFPKGDELEPNEEG
LAFYDAVFDELNKYGIEPLVTLSHYEFPLHLALEYGGWKNRKVIEFFVRYAETVFKRYQG
KVKYWLTFNEINILGMVGYLSGGLLFEDGKNDLEAMYQAVHHQFIASSLATKAAHEIDPE
NKVGCMLARMENYAATCNPDDVLAALKKDQENLFYTDVQVRGAYPSYMKRFFKENNIQVV
FEPGDEAILKQYPVDFMSFSYYMTSITRALPDKDKATAGNLILGEANPYLEASDWGWQID
PVGLRITLNKLYDCYQVPLFIVENGLGALDKVEADGSIEDGYRIAYLEKHIQQMYEAIED
GVELMGYTPWGCIDLVSASTSEMSKRYGFIYVDADDQGKGSFDRSRKASFYWYKDVIASN
GANVLTEK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaatttccaaaaggatttctttggggcggtgcaacagcggccaaccaatat
gaaggtggttggaatttgggaggtcgtggtccagccacttccgatacctatatagcggtc
gatccagataagcggaaggatatgagtcactttggtaagcctgtctcgcgggctgatgtg
gaatttgccttggcagatcaagaaggactctacccaaaacgttggggttctgatttctat
catcgctacaaggaagacattgccctctttgcagaaatgggcttcaagaccttccgcttg
tcgattgcctggtctcgtatttttccaaaaggagacgagttagaaccgaatgaagaagga
ctggccttttatgatgcggtcttcgatgagctgaataaatatggtatcgagccactggtg
accctatctcactatgaatttcctcttcatcttgctctagaatacggtggctggaaaaac
cgtaaggtcatagagttctttgttcgctatgccgagacagtattcaaacgctatcagggt
aaagttaagtattggctgacttttaatgagatcaatattttgggcatggttggttatcta
tcaggcggtcttctcttcgaagacggaaagaatgacctagaagccatgtaccaagcagtt
caccatcagtttatcgcttctagtttggcaacaaaagctgcccatgaaattgacccagaa
aacaaggttggttgcatgctggcacggatggagaactatgcagccacctgcaatccagac
gatgtcttggcggccttgaaaaaagaccaggaaaatctcttctatacagatgtgcaggtg
cgtggagcctacccaagttatatgaaacgcttcttcaaagaaaacaatatccaggtcgtg
ttcgagccgggagacgaagcgattttgaaacaatatcctgttgatttcatgagtttttct
tactatatgacatccatcacccgtgctcttccagacaaggacaaggcaacggcaggtaat
ttgatactaggagaggccaatccttatctggaagcgtcggactggggctggcagatagac
cctgtcggacttcgtatcaccctcaacaagctttatgactgttaccaagttcccctcttc
atcgtggaaaatggtctgggagccttggataaggtggaggcagacggcagtattgaggac
ggctaccgtattgcctacctagaaaaacacatccagcaaatgtatgaagctattgaagac
ggtgtggaacttatgggctataccccttggggctgtatcgatctggtttctgcttcaacc
agtgagatgtccaaacgctacggctttatctatgtggatgcggacgatcaaggaaagggc
agttttgaccgatcacggaaggcatcattctactggtataaagatgtcattgccagcaat
ggagccaatgtattgacagaaaaatag

DBGET integrated database retrieval system