KEGG   Streptococcus salivarius CCHSS3: SALIVB_0443Help
Entry
SALIVB_0443       CDS       T01580                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase (methionine--tRNA ligase) (MetRS)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00450  Selenocompound metabolism
ssr00970  Aminoacyl-tRNA biosynthesis
ssr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SALIVB_0443 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SALIVB_0443 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssr01007]
    SALIVB_0443 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssr03016]
    SALIVB_0443 (metG)
Enzymes [BR:ssr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SALIVB_0443 (metG)
Amino acid related enzymes [BR:ssr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SALIVB_0443 (metG)
Transfer RNA biogenesis [BR:ssr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SALIVB_0443 (metG)
 Prokaryotic type
   Other AARSs
    SALIVB_0443 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CCB92751
UniProt: F8LHD1
Position
420247..422238
Genome map
AA seq 663 aa AA seqDB search
MTKTFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQKA
EEAGITPQEYVDGMAVGVKDLWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYLG
EYSGWYSVSDEEFFTESQLSEVFRDEDGNVTGGIAPSGHQVEWVSEESYFLRLSKYQDRL
VEFFKSHPDFITPDGRLNEMLKNFIEPGLEDLAVSRTTFTWGVKVPSNPKHVVYVWMDAL
LNYVTALGYGQDEHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDIKLPERLIAHG
WFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVARINYEL
ANDLGNLLNRTVAMINKYFGGQVPAYVENVTDFDADLAKVVAENIEEFHKQMNAVDFPRA
LDAVWNIISRTNKYIDETAPWVLAKEDGDKEQLAAVMAHLAASLRVVAHLIQPFMMTTSN
AIMEQLGLSGAFDLENLELSGFPENVTVISKGTPIFPRLDMDEEIAYIQSQMNAGKPQEK
EWNPEEVELKSEKDQIKFDDFDKVEIRVAEVKEVEKVEGSDKLLRFRLDAGDGEDRQILS
GIAKFYPNEQELVGKKLQVVANLKPRKMMKKYVSQGMILSAEHDGKLTVLTVDSSVPNGS
VIG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacattctacatcacaacacctatctactacccatctggtaaattgcatatt
ggttctgcctatacaaccattgcttgtgacgtcttggcacgttacaaacgtatgatgaac
tatgatgtcttctaccttactgggcttgatgagcacggtcaaaagattcaacaaaaggct
gaagaagcaggaatcactccacaagagtatgtggacggcatggctgttggtgttaaggac
ctctggcaacttttggatatctcatacgataaattcatccgtacgactgatgattaccat
gaaaaagtagtggcacaagtttttgagcgcttacttgctcaagatgatatttacttgggt
gaatactctggttggtactcagtctcagatgaggaattctttacagaaagtcagctgtcg
gaagttttccgtgatgaagatggaaatgtaacgggaggtattgctccatcaggacaccaa
gtagaatgggtatctgaagaatcttacttccttcgtctcagtaaataccaagaccgcttg
gtagaatttttcaaatcgcatcctgatttcatcactccggatggtcgccttaatgaaatg
cttaaaaacttcatcgagccaggtttggaagacttagccgtgtcacgcacaaccttcact
tggggggttaaagtcccatccaatcctaaacacgtggtctacgtctggatggatgctctt
ctcaactatgtgactgctcttggttatggtcaggatgagcatgctaactttgacaagttc
tggaacggaactgtcttccacatggtcggaaaagacatccttcgcttccactccatctac
tggccaatcctcctcatgatgttggacattaaattgccagaacgtttgattgcccacggt
tggtttgtcatgaaagacggtaagatgtctaagtctaaaggaaatgtgatctatccagaa
atgttggtagaacgttttggtcttgatccactccgttactacctcatgcgtagtcttcct
gtcggttcagatggtaccttcacaccagaagactatgtggctcgtattaactacgagttg
gctaatgaccttggaaacctcctcaaccgaacagttgccatgattaacaagtatttcggt
ggtcaagtgcctgcctatgttgagaacgttacagactttgatgctgatttggctaaggtt
gtggctgaaaatatcgaagagttccacaaacaaatgaacgctgtagatttcccacgtgcc
ttggacgccgtttggaacatcatttcacgtaccaataagtatattgatgaaacagctcca
tgggttctcgccaaagaagatggtgacaaggaacaattggcagcagttatggctcacttg
gctgctagtcttcgtgtcgttgcccacctcattcaaccattcatgatgaccacttcaaat
gccattatggaacagctcggattgtcaggagcgtttgaccttgaaaatcttgaactttca
ggattcccagaaaatgtgacagtcatttcaaaaggaactccaatcttcccacgtctggat
atggacgaggaaattgcctacatccaatctcaaatgaacgcaggcaaacctcaagagaag
gaatggaacccagaagaggttgaacttaagtctgaaaaagaccaaatcaaatttgatgac
tttgacaaggttgaaatccgtgtcgctgaagttaaagaagtagaaaaagtcgaaggttca
gacaaattgcttcgcttccgtcttgacgctggtgacggtgaagatcgtcaaatcctctca
ggtattgctaaattctatccaaacgaacaagaattggtcggcaagaaacttcaagtcgtg
gctaatctcaaaccacgtaagatgatgaagaaatatgtcagccaaggtatgattctttcc
gcagaacatgacggcaaactcactgtcttgacagtagattcatcggttccaaacggaagt
gtgattgggtaa

DBGET integrated database retrieval system