KEGG   Streptococcus salivarius CCHSS3: SALIVB_0909Help
Entry
SALIVB_0909       CDS       T01580                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssr  Streptococcus salivarius CCHSS3
Pathway
ssr00010  Glycolysis / Gluconeogenesis
ssr00350  Tyrosine metabolism
ssr00625  Chloroalkane and chloroalkene degradation
ssr00626  Naphthalene degradation
ssr01100  Metabolic pathways
ssr01110  Biosynthesis of secondary metabolites
ssr01120  Microbial metabolism in diverse environments
ssr01130  Biosynthesis of antibiotics
ssr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SALIVB_0909
  Lipid metabolism
   00071 Fatty acid degradation
    SALIVB_0909
  Amino acid metabolism
   00350 Tyrosine metabolism
    SALIVB_0909
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SALIVB_0909
   00626 Naphthalene degradation
    SALIVB_0909
Enzymes [BR:ssr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SALIVB_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCB93201
UniProt: F8LIN1
Position
1002014..1002460
Genome map
AA seq 148 aa AA seqDB search
MAVDINQDKLALAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVVTAVSKVAFNQAIDS
VRAGGTVVAVGLPSEYMDLSIVKTVLDGIRVVGSLVGTRKDLEEAFDFGAQGLVVPVVET
VPVDTAVEVFDQMEKGEIQGRKVLDFTK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttgatatcaaccaagataaacttgctttggctaaggaatctggtgctgattta
gtggtgaacggtaaagaagttgaagatgtagcaggttatatccaagaaaaaactggtggt
acacacagtgctgttgtaacagcggtttctaaggttgctttcaaccaggctatcgatagt
gtacgtgctggtggaacagtcgttgcggttggtctcccatcagaatatatggatctctca
attgtcaaaacagttctagatggtatccgtgttgttggatctcttgtaggtacacgtaaa
gacttggaagaagcctttgacttcggtgcacaaggcttggtagtaccggttgttgaaact
gttcctgttgatacagcggtagaagtctttgatcaaatggaaaaaggtgaaattcaagga
cgtaaagtattggatttcactaagtaa

DBGET integrated database retrieval system