KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_0160Help
Entry
SSUSC84_0160      CDS       T00937                                 

Definition
(GenBank) putative alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00052  Galactose metabolism
sss00561  Glycerolipid metabolism
sss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSUSC84_0160
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSUSC84_0160
   00600 Sphingolipid metabolism
    SSUSC84_0160
Enzymes [BR:sss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SSUSC84_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 GHL6
Motif
Other DBs
NCBI-ProteinID: CAZ50938
Position
157462..159663
Genome map
AA seq 733 aa AA seqDB search
MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETASYQYVREDEYRALTSF
VEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSHFVYQGHAIYAGRSALKGL
PHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAVTRSARFEQLGEKSVCLNRAL
SMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSIYSLKGASSAEHNPFMALKRPTA
DEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGIHPERFSWTLDKGEEFQTPEVVMVY
SEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLLNNWEAMSFDFDEETILSLAKEAAGLG
VELFVMDDGWFGKRNHDRAGLGDWTVNREKLPSGLTGIIDQVHAMGMKFGLWIEPEMVNR
DSELYRAHPDWIFHHPQHSQSHGRHQYTLDLSREDVYQNIHDQLHRLLAEHDIDYIKWDM
NRYMTEVFTCTREADRQGETFHRYILNLYRLYDSLIAAFPTVLFESCSSGGARFDPGMLY
YAPQTWVSDDTDAMERLKIQYGTSMVYPLNSMGCHVSASPNQQLGRATPLNTRANVAFFG
SFGYELDLFECSQEELEEMKEQIAFYKTHRKIFQQGIFTRLKSPFDGEITAWQVQSSDGQ
QVIVGYYRRLTTANLSYQRLYLQGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNK
DFTSCLMVLQKQQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgggaattatctttcatgaaaagacaaaggaattccatctttacaatgagtttattagc
tatgtgttgacggtcttgcctaatggtcatattggtagtttgtattatggaaagcgtgta
acagaaacagcttcttatcagtatgtacgtgaagatgagtatcgtgctttgacttccttt
gtagaagacgatgaccgtttcttttcgctccaatatgccaatcctgaatttgcttgttat
ggtacaacggactatttttctccgacttttgagttggtgcagaaggatggtagcagtcta
tcgcactttgtgtatcaaggtcatgcgatttatgctgggcgatcggctttgaagggtctt
cctcatctctatctggatgaggagggacaggcagatagtttggatatttatttgttggat
gaagattcgcagacccggctggtcttgtcttatacgatttttcgagattatccagcggtg
actcgctctgctcgttttgaacaactcggagaaaaatctgtctgtttgaaccgtgccttg
agtatgacactttgtctgcctgatatggactatgattggttgcatttggatggggcttgg
gggcgtgagcggcatctgcaactatcgcctcttcatcaaggttgtcagtctatttacagt
ctcaaaggggctagtagtgcggagcacaatccctttatggctttgaaacgcccaactgcg
gatgagcaacagggagaggtactaggcttctcgctcgtctatagcggaaactttttggcg
caggtggatgtgagttctttccaaaaaacaagagtgagtatgggaatccatcctgagcgt
ttttcttggacattagataagggagaagagttccagacgcctgaggttgttatggtttat
agcgagcatggtttgaatggcatgagccaaacctatcaccgcctcttccaaaaacatctg
gtacgtggctattggcgtgatagagaacgacctgttctcttgaataactgggaagccatg
agttttgattttgatgaggaaacaattctttccttggccaaagaggctgcaggtcttggt
gttgaactctttgtcatggatgatggttggtttggcaagcgaaaccatgaccgagcaggc
ttgggagattggacggtcaaccgagagaaattaccaagtggcttgacagggattattgac
caagttcatgctatgggaatgaaatttggactttggatcgaacctgaaatggtcaatagg
gacagcgagctttaccgagcgcatccagactggattttccatcatcctcagcatagtcaa
tcgcacggacgccaccaatatacgctggatttgtcgagggaggatgtttatcaaaatatt
catgaccaactccatcggctgttggctgagcatgatattgattatatcaagtgggacatg
aatcgctatatgacagaggtctttacatgtacacgggaggcggatcgacaaggtgagacc
ttccatcgctatattctcaatctctaccgtttatatgatagcctgatagcagcttttccg
acagtcttattcgaatcttgttcaagtggtggagctagatttgatccagggatgctctac
tatgcaccgcaaacctgggtcagcgatgacacggacgccatggaacgcttgaaaatccaa
tatggaacgagcatggtctatcctttgaatagtatgggttgccatgtgtcagctagtcca
aatcagcagttggggcgtgctactccactaaacacacgtgccaatgttgcattctttgga
agttttggctatgaattggatttgtttgagtgtagccaagaagagttggaagagatgaaa
gagcagattgccttttacaagactcaccgtaagattttccaacagggtattttcactcgt
ctgaaaagtccattcgatggagaaataacggcttggcaggtccaatcctcggatggtcag
caagtcatcgtgggttattatcgtcggttgacaacggctaatctctcctatcaacgcttg
tatttgcagggattggaagaggaagcggtctatcaccttgatggagaagtttatactggt
agccaattaatgcatacaggtttgtcgattcgacatggggaccatgttggagacaataag
gactttacttcttgtttgatggtccttcagaaacaacagtag

DBGET integrated database retrieval system