KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_0249Help
Entry
SSUSC84_0249      CDS       T00937                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00010  Glycolysis / Gluconeogenesis
sss00071  Fatty acid degradation
sss00350  Tyrosine metabolism
sss00625  Chloroalkane and chloroalkene degradation
sss00626  Naphthalene degradation
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01130  Biosynthesis of antibiotics
sss01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_0249 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUSC84_0249 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUSC84_0249 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUSC84_0249 (adhP)
   00626 Naphthalene degradation
    SSUSC84_0249 (adhP)
Enzymes [BR:sss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUSC84_0249 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N MCR_alpha Methyltransf_25 Methyltransf_31 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAZ51027
Position
complement(265108..266133)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcggactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggattgctatctatggtgctggtggacttggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgccgtagacatcaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
cctggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggatatgtagtagct
gtcggacttccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtc
ttcaatgaaatggttgccggtactatccaaggtcgtatggtcttagacttctgccactca
cactaa

DBGET integrated database retrieval system