KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_0392Help
Entry
SSUSC84_0392      CDS       T00937                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00010  Glycolysis / Gluconeogenesis
sss00052  Galactose metabolism
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01130  Biosynthesis of antibiotics
Module
sss_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_0392
   00052 Galactose metabolism
    SSUSC84_0392
Enzymes [BR:sss01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSUSC84_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAZ51170
Position
436814..437815
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttgatgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaactattgtcccagtagcggggcgtatttcaggtgcc
caagctgagatagagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgccaacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacttggtaa

DBGET integrated database retrieval system