KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_0576Help
Entry
SSUSC84_0576      CDS       T00937                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00480  Glutathione metabolism
sss00590  Arachidonic acid metabolism
sss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SSUSC84_0576
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SSUSC84_0576
Enzymes [BR:sss01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSUSC84_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAZ51354
Position
628702..629181
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYKDNGFVVLD
FPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggcacagaccagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctataaagacaacggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggttctgcggaagacatcaatcagatc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system