KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1323Help
Entry
SSUSC84_1323      CDS       T00937                                 

Definition
(GenBank) Mur ligase family protein
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00300  Lysine biosynthesis
sss00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSUSC84_1323
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUSC84_1323
Enzymes [BR:sss01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SSUSC84_1323
Peptidoglycan biosynthesis and degradation proteins [BR:sss01011]
 Precursor biosynthesis
  Amino acid ligase
   SSUSC84_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M Zn_Tnp_IS1595 eIF-5_eIF-2B zinc_ribbon_10
Motif
Other DBs
NCBI-ProteinID: CAZ52099
Position
1412835..1414178
Genome map
AA seq 447 aa AA seqDB search
MKINTALGILAGKSSQFILKKLGRGTTLPGKIALKFDKHILDSLAKDYEVVVVTGTNGKT
LTTALTVGILQEAFGEITTNTSGANMITGITATFLSAKKNKNGKKIAVLEIDEASLARVT
DFIKPSLIVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPQATILANGDSPLFNSTNVINP
VKYYGFATEEHEPRLAHYNTEGVLCPHCHQIIQYKLNTYANLGSYICTNCGFSRPELDYK
LTKLKEITNTSSTFVIDGQDYKINIGGLYNIYNALAAVSVAEFFGVSPEKIKAGFDKSKA
VFGRQETFKLGDKDCTLVLIKNPVGATQAIEMMKLAPYDFSLSVLLNANYADGIDTSWIW
DADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYPENQITETPKLEDIMTLIEQSSSQHA
YILATYTAMLEFRDLLAQRQAVGKEMK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagctttgggtattctagcaggaaaaagttcccagttcattttgaaa
aaactaggacgtggtactaccctacctggaaaaattgccctcaaattcgataaacatatt
ttagatagtttggctaaggattatgaagtcgttgttgtgacaggtactaacggaaagact
ctgaccaccgccctgacagttggtatcctccaagaagcctttggcgaaatcacgaccaat
accagcggtgccaatatgatcacaggaattacggcaacctttttgtctgccaagaaaaat
aaaaacggcaagaagattgccgtcttggagattgacgaagcaagtcttgcccgtgtaacc
gactttataaagcctagtctgattgtctttaccaatatcttccgtgaccagatggaccgc
tacggtgagatttataccacctaccagatgattttggacggggctgcaaaagctccgcag
gcaactattttggccaatggtgatagtccacttttcaactcaacgaacgttatcaatcca
gtaaaatactacggttttgcgacggaagagcatgagccacgtctggcccattacaatacc
gaaggcgttctctgtcctcattgccaccagattatccagtacaagctcaatacctacgcc
aacttgggtagctacatctgtaccaactgtggctttagccgacctgaactggactacaag
ttgaccaaactaaaagaaatcaccaatacttcttctacctttgtcattgacggtcaggat
tataagattaacatcggaggcctctacaacatctacaatgccctagcagctgtcagcgta
gcagaatttttcggcgtatctcctgaaaaaatcaaggcaggatttgacaaatcaaaggca
gtcttcggtcgccaagaaacatttaagttgggtgataaagattgtacattggtcttgatt
aaaaaccctgtcggtgcaacccaggctattgaaatgatgaaactggctccatacgatttt
agcctgtccgtccttctcaatgccaactacgctgacggaattgataccagctggatttgg
gatgctgactttgaacaaatcacccaaatggacattccacaagtctttgcaggcggtgtt
cgttcgtctgaaattgcccgtcgcctccgtgtgactggctatcctgagaaccagattact
gaaacaccaaaactagaagacatcatgaccttgattgagcaatcgagtagtcagcatgct
tatattttagctacttatacagctatgctcgaattccgtgacctgctggctcaacgccaa
gccgttggaaaggagatgaaataa

DBGET integrated database retrieval system