KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1480Help
Entry
SSUSC84_1480      CDS       T00937                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00010  Glycolysis / Gluconeogenesis
sss00260  Glycine, serine and threonine metabolism
sss00680  Methane metabolism
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01130  Biosynthesis of antibiotics
sss01200  Carbon metabolism
sss01230  Biosynthesis of amino acids
Module
sss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sss_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUSC84_1480 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SSUSC84_1480 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSUSC84_1480 (gpmA)
Enzymes [BR:sss01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSUSC84_1480 (gpmA)
Membrane trafficking [BR:sss04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SSUSC84_1480 (gpmA)
Exosome [BR:sss04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSUSC84_1480 (gpmA)
  Exosomal proteins of melanoma cells
   SSUSC84_1480 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Imm70
Motif
Other DBs
NCBI-ProteinID: CAZ52256
Position
complement(1553060..1553752)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGLNKAEAAAEFGDEQVHIWRRSYDTL
PPEMAKDHEHSAHTDRRYAHLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFELDENLNIVKEYYLEA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccatggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcaatcgatgcaggt
aaattgatcaaagaagcaggtatcgaatttgaccttgctttcacatctgtattgaaacgt
gctatcaagactacaaacttggctcttgaagctgcagatcaattgtgggtaccagttgaa
aaatcgtggcgtttgaacgaacgtcactacggtggtttgactggcttgaacaaagctgaa
gcagctgctgaatttggtgatgagcaagttcacatctggcgtcgttcttatgatactttg
ccaccagaaatggctaaagatcatgagcattcagcacacactgaccgtcgctatgcacac
cttgatgattcagttattccagatgcagaaaacttgaaagtaacgcttgagcgtgccctt
ccattctgggaagataaaattgctccagcattgaaagacggtaaaaacgtattcgtgggt
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtctgatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtattcgaattggatgaaaacttg
aacattgtgaaagagtactacttggaagcataa

DBGET integrated database retrieval system