KEGG   Streptococcus suis SC84 (serotype 2): SSUSC84_1481Help
Entry
SSUSC84_1481      CDS       T00937                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sss  Streptococcus suis SC84 (serotype 2)
Pathway
sss00071  Fatty acid degradation
sss00072  Synthesis and degradation of ketone bodies
sss00280  Valine, leucine and isoleucine degradation
sss00362  Benzoate degradation
sss00380  Tryptophan metabolism
sss00620  Pyruvate metabolism
sss00630  Glyoxylate and dicarboxylate metabolism
sss00640  Propanoate metabolism
sss00650  Butanoate metabolism
sss00900  Terpenoid backbone biosynthesis
sss01100  Metabolic pathways
sss01110  Biosynthesis of secondary metabolites
sss01120  Microbial metabolism in diverse environments
sss01130  Biosynthesis of antibiotics
sss01200  Carbon metabolism
sss01212  Fatty acid metabolism
sss02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUSC84_1481 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSUSC84_1481 (atoB)
   00640 Propanoate metabolism
    SSUSC84_1481 (atoB)
   00650 Butanoate metabolism
    SSUSC84_1481 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSUSC84_1481 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSUSC84_1481 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUSC84_1481 (atoB)
   00310 Lysine degradation
    SSUSC84_1481 (atoB)
   00380 Tryptophan metabolism
    SSUSC84_1481 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUSC84_1481 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUSC84_1481 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSUSC84_1481 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sss04147]
    SSUSC84_1481 (atoB)
Enzymes [BR:sss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUSC84_1481 (atoB)
Exosome [BR:sss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUSC84_1481 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: CAZ52257
Position
1553978..1555162
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system