KEGG   Streptococcus suis ST3 (serotype 3): SSUST3_0807Help
Entry
SSUST3_0807       CDS       T01470                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sst  Streptococcus suis ST3 (serotype 3)
Pathway
sst00480  Glutathione metabolism
sst00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sst00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SSUST3_0807
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SSUST3_0807
Enzymes [BR:sst01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSUST3_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEB81259
Position
817798..818277
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSIAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYRGQGFVVLD
FPCNQFLNQAPGSAEDINQTCSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIEFYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggaacagatcagtccatagctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctatcgaggccaaggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggctctgcggaagacatcaatcagacc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctgtatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaattttacctagaaaaataa

DBGET integrated database retrieval system