KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_0714
Entry
SSU05_0714        CDS       T00514                                 

Name
(GenBank) Pyruvate-formate lyase
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABP89680
UniProt: A4VU91
Position
689580..692024
AA seq 814 aa
MKTVTEVAGTSIKTEYFGSLTDRMNKYREDVLDKKPYIDAERAVLATKAYQEHREKPNVL
KRAYMLKEILENMTLYIEEESLIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVF
YITEETKEQLRSIAPFWEKNNLRSRAGVLLPEEVQVYMETGFFGMEGKMNSGDAHLAVNY
QKVLEQGLRGFEERVRVAKANLDLTDPASIDKYHFYDSIFIIIDAVKAYADRFVALATEL
AEKAPTAQRRQELLEIARICAKVPYEPAETFAEAVQSVWFIQCILQIESNGHSLSYGRFD
QYMYPYVKADLEAGRETEDSIVERLTNLWIKTITINKVRSQSHTFSSAGSPLYQNVTIGG
QTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDARFMNECIEVMKLGFGMPAFN
NDEIIIPSFIEKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYMNFPKVLLITMNDGI
DPASGKRFAPAFGHFKDMKSFEVLETAWEKTLRHLTRMSVIVENAIDIALEREVPDILCS
ALTDDCIGRGKHLKEGGAIYDYISGLQVGIANLSDSLAAIKKLVFEEGRLTPEELWHALE
TDYAGERGKEIQEMLIEDAPKYGNDDDYADQLVTAAYDIYINEIAKYPNTRFGRGPIGGI
RYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCSPSHNMDKNGPTSVLKSVAKLPTHE
IVGGVLLNQKVNPQTLAKEEDKQKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQLHPEK
HRDLIVRVAGYSAFFNVLSRATQDDIIGRTEHTL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaaaacagtgactgaagtagctggcactagcattaaaactgagtattttggaagtctg
actgatcggatgaacaaatacagagaagatgtccttgataagaagccctatattgacgcg
gaacgggctgttttagcaacaaaagcctatcaagaacatagagagaagcccaatgtatta
aaaagggcctatatgctcaaggaaatattggagaacatgacgctttatattgaagaagaa
agtctgattgcaggtaaccaagcttcttcaaataaagatgctcccatcttcccagaatat
accttggagtttgtattgaatgaattggatttattcgaaaaacgggatggggatgtcttc
tatattaccgaggaaactaaagagcagttgcgcagcatcgctccattctgggaaaagaat
aatcttcgttcacgtgcaggtgtcttgcttccagaagaagttcaagtttatatggaaact
ggcttctttggtatggaaggtaagatgaactctggcgatgcccacttggctgtcaattac
caaaaggtattggaacaaggtttgcgtggttttgaggagcgagttcgtgtagcaaaggct
aatctcgatttgacggatcctgcaagtattgataaatatcatttctatgactcaatcttt
atcatcattgatgcggtgaaagcatacgcagatcgttttgtcgccttggctactgaattg
gcagagaaagcaccaacagctcaacgccgtcaagaactactggagattgcacggatttgt
gcgaaggtgccgtatgaacctgctgaaacatttgcagaggcagtgcaatcggtctggttt
atccagtgtatcttgcaaatcgagtccaatggacattctctatcctatggacgtttcgac
caatacatgtatccgtatgtgaaagctgatttagaagcaggacgtgaaacggaagacagc
atcgtcgaacgcttaactaacttgtggattaagaccattactatcaacaaggttcgtagt
caatcacataccttctcatctgctggtagtccactataccaaaatgtaaccattggtgga
caaacacgtgataagaaggatgctgtcaatccactttcttacttagtattgaaatctgtt
gcccaaacacacctgccacagccaaacttgactgttcgctatcatgcaggcctagatgct
cgcttcatgaatgaatgtattgaagtcatgaaacttggttttggtatgcctgcctttaac
aacgatgaaattatcattccctcctttatcgagaaaggtgtcttggaagaagatgcctat
gactacagtgcgattggctgtgtagaaacggctgttcctggtaaatggggataccgttgt
acaggtatgagctatatgaacttcccgaaagttttattgattaccatgaatgatggtatc
gatcctgcatcaggcaaacggtttgcaccagcctttggtcacttcaaagatatgaaatcc
tttgaagtgcttgaaacggcatgggaaaagacacttcgtcatctaacacggatgagtgtc
atcgttgaaaatgcaattgacattgctttagaaagagaagtaccagacattctctgctca
gctctgacagatgactgtatcggtcgtggtaagcacctgaaagaaggtggagcgatttac
gattacatttctggtctgcaggttggcattgccaatttatctgattctctagcagcaatc
aaaaaattagtctttgaagaaggacgattgactccagaagaattatggcatgctttggaa
acagactatgctggggagcgtggtaaagaaatccaggaaatgttgattgaagatgcacca
aaatatggtaacgatgatgattatgcagaccaattggtaacagcagcatatgatatttat
atcaatgagattgccaaatatccaaacactcgctttggtcgtggtccgattggtggtatc
cgctattcaggtacatcatccatttcagccaacgttggacaggggcgtggtactttggca
actccagacggtcgcaatgcaggaacaccgttggcagaaggttgttctccatcacataat
atggataaaaatggaccgacatccgttttgaaatcagttgccaaattaccaacacatgaa
attgttggaggcgttctgctcaatcagaaggtcaatccacaaacacttgccaaagaagaa
gacaaacaaaaattaattgccctcttgcggacattctttaaccgcttgcatggctatcat
attcagtacaatgttgtctctcgagaaaccttgattgatgcacaactacatcctgaaaaa
caccgtgatttgattgtccgtgtagcaggttattcagcattcttcaatgtattgtcgaga
gcaacacaagacgacatcattggtcgtacagaacatacattgtaa

DBGET integrated database retrieval system