KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_0076Help
Entry
SSU05_0076        CDS       T00514                                 

Definition
(GenBank) Ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SSU05_0076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssu03011]
    SSU05_0076
Ribosome [BR:ssu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SSU05_0076
  Bacteria
    SSU05_0076
  Archaea
    SSU05_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABP89048
UniProt: A4VSF9
Position
75410..75754
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTPNKAAGIIEGVLNSAIA
NAENNFGLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINKRTAHITVVVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaactgctcgcacagtacgtgtttcacctcgtaaa
tcacgtcttgtcttggataacatccgtggcaaaagcgtagcagacgcaatcgcaatcttg
aaattcacaccaaacaaagctgcaggcattatcgagggagttttgaactcagcaatcgct
aacgctgaaaacaactttggtttggaaaaagctaacttggtagtcagcgaagcattcgca
aacgaaggaccaacgttgaaacgtttccgtccacgtgcgaaaggttctgcttcaccaatt
aacaaacgcacagctcatatcactgtagttgtggcagagaaataa

DBGET integrated database retrieval system