KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_0279Help
Entry
SSU05_0279        CDS       T00514                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00010  Glycolysis / Gluconeogenesis
ssu00071  Fatty acid degradation
ssu00350  Tyrosine metabolism
ssu00625  Chloroalkane and chloroalkene degradation
ssu00626  Naphthalene degradation
ssu01100  Metabolic pathways
ssu01110  Biosynthesis of secondary metabolites
ssu01120  Microbial metabolism in diverse environments
ssu01130  Biosynthesis of antibiotics
ssu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU05_0279
  Lipid metabolism
   00071 Fatty acid degradation
    SSU05_0279
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSU05_0279
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSU05_0279
   00626 Naphthalene degradation
    SSU05_0279
Enzymes [BR:ssu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSU05_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N MCR_alpha Methyltransf_25 Methyltransf_31 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABP89247
UniProt: A4VT08
Position
complement(265182..266207)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgag
caatgtattgtaacagcggactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcacttg
gaaccaggtcaatggattgctatctatggtgctggtggacttggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgccgtagacatcaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
cctggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggatatgtagtagct
gtcggacttccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgccctgtcgaagatgccgaagcagtc
ttcaatgaaatggttgccggtactatccaaggtcgtatggtcttagacttctgccactca
cactaa

DBGET integrated database retrieval system