KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_0723Help
Entry
SSU05_0723        CDS       T00514                                 

Definition
(GenBank) alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00564  Glycerophospholipid metabolism
ssu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SSU05_0723
Enzymes [BR:ssu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SSU05_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABP89689
UniProt: A4VUA0
Position
702150..703988
Genome map
AA seq 612 aa AA seqDB search
MNRMEFSKETRRLAIERMQDRQLDLLIIGGGITGAGVALQAAASGMETALIEMQDFAEGT
SSRSTKLVHGGLRYLKQFDVEVVSDTVSERAVVQNIAPHIPKPDPMLLPVYDEPGSTFSL
FRLKVAMDLYDLLAGVNNTDMANKVLTREEVLEREPNLKQEGLIGGGVYLDFRNNDARLV
IENIKRAAKDGALIASRAKAEKFIKDDAGKVVGIVARDLLTDRTFEIRARLVINTTGPWS
DEVRNLGGEGSGVLQMRPTKGVHLVVDSSRLSVPQPTYFDTGHADGRMVFVLPRENKTYF
GTTDTDYTGDLANPMVTQEDVDYLLDIVNNRFPEANLTLDDIESGWAGLRPLLSGNGASD
YNGGNNGKLSDDSFNSLIETVKGYMNNEKTRDDVEHDLTHLEGSVSEKHLDPSAVSRGSA
LDRDDNGLLTLAGGKITDFRKIAEGAIEKVADILKEEHGRSFKLINSKTYPVSGGELNPA
NVAEEIEHLAQLGVKKGLLYDDALYLANLYGSNAPKVFVLNHKVEAVSGLNKRDLLSLHY
AMKEEMTLTAVDYLLRRTNYMLFMREQLDAVALEIIKEMAAYYAWSEEEVAQQKQLLADT
LVKNDLTYLKEK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgtatggaattttcaaaagaaacaagacgcttagctattgagcgaatgcaggat
cgtcaacttgacctcctcattatcgggggtggtattacaggtgcaggtgtggctttgcag
gcagcagcaagcggtatggaaacagccttgattgaaatgcaggactttgcagaaggaact
tccagtcgctcaaccaaattggtccacggtggtcttcgctacctcaaacaatttgacgtg
gaagtggtatccgataccgtatctgaacgtgctgtagtacaaaatatcgccccacatatt
ccaaagccagacccaatgcttttaccagtctatgatgagccaggttctaccttcagcctc
ttccgtttgaaagtggccatggacttgtatgatctcttggctggcgtcaataataccgat
atggccaataaggtcttgacaagagaagaagtacttgaacgcgaaccaaacttgaagcaa
gaaggattgattggtggcggtgtctatcttgatttccgcaacaatgatgctcgtttggtt
attgaaaatatcaaacgtgcagccaaggatggtgccttgattgccagccgtgccaaagct
gagaaattcatcaaagatgatgctggaaaagttgtcggtatcgtcgctcgtgatttgctg
acagaccgcacctttgaaatccgtgcgcgtttggtcatcaatacaacaggaccatggagt
gatgaagtgcgtaatctgggtggagaaggttcaggcgttctccagatgcgtccgaccaag
ggtgtgcacctagttgtcgatagctctcgcttgtctgtaccacagccgacttactttgat
actggccatgcggatggtcgaatggtctttgtccttccgcgtgaaaataaaacctatttt
ggtacgactgatacagactatactggtgatttggcaaatccaatggtaacccaagaagat
gttgactacctgcttgatattgtcaacaatcgcttcccagaagcaaacttgaccctggat
gacattgagagtggttgggcaggtcttcgtcccctcttgtctggaaatggtgcttctgac
tacaatggtggaaacaacggtaagctcagcgatgacagctttaatagcttgattgaaacg
gtcaaaggttatatgaacaatgaaaagacacgtgacgatgtggaacatgatttgacccat
ctggaaggcagcgtttctgaaaaacacttggatccttcagctgtatcacgtggctctgcc
cttgaccgtgatgacaatggtttgctgactcttgctggtggtaagattactgacttccgt
aagatagcggaaggtgcaattgaaaaagtggcagacattctcaaagaagaacatggtcgc
agcttcaaactcatcaattctaagacctatccagtctctggtggtgaattgaaccctgca
aacgtagcagaagaaattgaacatcttgctcaactaggtgtgaagaaaggtctcctttat
gatgacgccctttacttggcaaacttgtacggttcaaatgctccaaaagtctttgtatta
aaccataaagtagaagccgtttctggcttgaacaagcgtgatttgctttcccttcactat
gctatgaaggaagagatgaccttgactgcagttgactatcttcttcgtcgtaccaactac
atgctctttatgcgtgagcagttggatgcagttgcgcttgaaatcattaaggaaatggca
gcttattatgcttggtcagaggaagaagttgctcaacagaaacaattgttggcagataca
cttgttaagaatgatttgacctatttgaaagaaaaatag

DBGET integrated database retrieval system