KEGG   Streptococcus suis 05ZYH33 (serotype 2): SSU05_2017Help
Entry
SSU05_2017        CDS       T00514                                 

Definition
(GenBank) argininosuccinate synthase (citrulline-asparate ligase)
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
ssu  Streptococcus suis 05ZYH33 (serotype 2)
Pathway
ssu00220  Arginine biosynthesis
ssu00250  Alanine, aspartate and glutamate metabolism
ssu01100  Metabolic pathways
ssu01110  Biosynthesis of secondary metabolites
ssu01130  Biosynthesis of antibiotics
ssu01230  Biosynthesis of amino acids
Module
ssu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ssu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSU05_2017
   00220 Arginine biosynthesis
    SSU05_2017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssu04147]
    SSU05_2017
Enzymes [BR:ssu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SSU05_2017
Exosome [BR:ssu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU05_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABP90983
UniProt: A4VXZ4
Position
complement(1922675..1923898)
Genome map
AA seq 407 aa AA seqDB search
MLIYIEMRKFMTKEKLILAYSGGLDTSVAIAWLKKDYDVIAVCMDVGEGKNLEFIHDKAL
SIGAIESHVLDVKEEFAQEYVLPALQAHAYYEQKYPLVSALSRPLISKKLVEMAHKTGAT
TIAHGCTGKGNDQVRFEVAIAALDPSLKVVAPVREWKWAREEEIIFAKENGVPVPADLDS
PYSVDQNLWGRANECGVLENPWNEAPEDTFGITTSPENAPDTPEYVDIEFKAGIPVAVNG
EKLSLANLIQRLNVIAGKHGVGRIDHVENRLVGIKSREIYECPGAITLLTAHKEIEDLTL
VREVSHFKPIVSNELSNLIYNGLWFNPATDALKAYLAQTQAVVNGTAKVKLYKGSAKVVA
RKSPNSLYDEDLATYTSADTFDQDAAVGFIKLWGLPTKVNAEIHKKS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgctaatatatatagaaatgagaaagtttatgacaaaagaaaaattaatcttggcctat
tctggtggacttgatacttcagttgcgattgcttggttgaagaaagactatgatgtcatt
gcggtttgtatggatgtaggtgaagggaaaaatctcgaatttattcatgacaaggccctt
tccatcggtgcaattgaatcgcatgttttggatgtgaaagaagaatttgctcaagaatac
gttttgcctgccctacaagcccatgcctactatgagcaaaaatatccgctggtatcggct
ctcagccgtcccttgatttccaaaaagttggtggaaatggctcataagacaggagcaacc
actatcgcccacggctgtactggtaagggaaatgaccaggtgcggtttgaggtagccatt
gcagccctggatccaagcttgaaagtcgtggctcctgtccgtgaatggaagtgggcgcgt
gaagaagaaatcatcttcgccaaggaaaatggtgttccagttcctgccgatctggacagt
ccttactcagtcgaccaaaacctctggggtcgtgccaatgagtgtggtgtcttggaaaat
ccatggaatgaagcgccagaagatacttttggcatcactacttctccagaaaatgcacca
gatactcccgagtatgtcgatattgagtttaaagcaggtattcctgttgctgtaaatggt
gaaaagttaagtcttgctaatctcattcaaagactcaatgtcattgctggtaaacatggt
gtgggtcggattgaccacgtggaaaatcgtttagtcggaatcaagtcacgggaaatttac
gagtgcccaggagctattacccttctgacagcccacaaggaaattgaagatttgaccctg
gtacgggaagtatcgcatttcaaaccgattgtttcaaatgaactctctaacttgatttac
aatggtttgtggttcaatccagcaacagatgccttgaaggcctatcttgctcagacccag
gcagttgttaatggcaccgcaaaagtgaaattgtataaggggtcagccaaagtagttgct
cggaaatctccaaattccctttatgacgaagatttggcaacctataccagtgcagatacc
tttgatcaagatgcggcagtcggtttcatcaagctttggggattgccaaccaaggtcaat
gcggaaattcataaaaagagctag

DBGET integrated database retrieval system