KEGG   Streptococcus suis T15: T15_1184Help
Entry
T15_1184          CDS       T02891                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ssui  Streptococcus suis T15
Pathway
ssui00260  Glycine, serine and threonine metabolism
ssui01100  Metabolic pathways
ssui01110  Biosynthesis of secondary metabolites
ssui01120  Microbial metabolism in diverse environments
ssui01130  Biosynthesis of antibiotics
ssui01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssui00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T15_1184 (ltaE)
Enzymes [BR:ssui01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     T15_1184 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGZ23275
UniProt: U5UIB7
Position
complement(1204075..1205103)
Genome map
AA seq 342 aa AA seqDB search
MLHFENDYNKGAHPALLEALVASNQEGLSGYGTDKYTESAIEKIKLATDCPHAQVTFLAG
GTQTNQIVISSMLASYEGVIAADTGHIAVHEAGAIEFTGHKVLALPHTDGKLVASEVENY
ISDFYADANHAHMVHPGMVYISHPTEYGTLYSKSELEALSTVCRHHNIPLFLDGARLGYG
LAARDTDLDLKTIAELTDVFYIGGTKLGALMGEALVFTKNNQPKNFVSIVKHHGALLAKG
RVTGVQFDCLFTDDLYLKLGRHAIAMAEQLTQILEEKGFQFYLKSPTNQQFVIVKNEELA
RLTEAGIAYGFWEKYDDSHSIIRFATSWSTSQADIDALRNRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgactataacaaaggtgcccatcccgccttgctagaagcctta
gttgcaagcaaccaagaaggtttatctggatatggcactgataaatatactgaatctgct
atcgaaaaaatcaaacttgctacggactgtcctcatgcacaagttacgtttttagcaggt
ggcacgcagaccaatcaaattgtcatttcgtctatgttagcttcctatgaaggagtcatt
gcagcggatactggtcatattgcagttcatgaagcaggggcaattgaatttacaggccat
aaggtgttggccttaccgcatacggatggcaaacttgtcgcaagtgaagttgagaactat
atttccgatttctacgcagatgctaatcatgctcacatggttcatccaggaatggtttat
atttcccatccaacagagtatggtacactttatagcaagtcagagttagaagccttgtca
acagtttgtcgtcatcataacatcccgctttttttagatggagctcgcttgggttatggt
cttgctgcacgcgatacggatcttgatttgaagacaattgcagagctgacagatgttttc
tacattggtgggacaaaactcggtgccttgatgggggaagctttagtatttacaaagaac
aaccagcctaagaatttcgtatcgattgtcaaacaccatggtgccttgttggcgaaagga
agagtgacaggtgtccagtttgattgcttatttactgatgacttgtatcttaaattgggg
cgtcatgctatcgcaatggcagagcaactgacccagattctggaagagaaaggttttcaa
ttctatctcaaatcaccgaccaatcagcaatttgttattgttaagaatgaagaattggct
agattgacagaagctggaattgcctatggcttctgggagaaatacgacgatagccacagt
atcatccgctttgcgaccagctggtcaactagtcaagcggatattgatgcgttaaggaat
agattataa

DBGET integrated database retrieval system