KEGG   Streptococcus suis T15: T15_1653Help
Entry
T15_1653          CDS       T02891                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssui  Streptococcus suis T15
Pathway
ssui00071  Fatty acid degradation
ssui00072  Synthesis and degradation of ketone bodies
ssui00280  Valine, leucine and isoleucine degradation
ssui00362  Benzoate degradation
ssui00380  Tryptophan metabolism
ssui00620  Pyruvate metabolism
ssui00630  Glyoxylate and dicarboxylate metabolism
ssui00640  Propanoate metabolism
ssui00650  Butanoate metabolism
ssui00900  Terpenoid backbone biosynthesis
ssui01100  Metabolic pathways
ssui01110  Biosynthesis of secondary metabolites
ssui01120  Microbial metabolism in diverse environments
ssui01130  Biosynthesis of antibiotics
ssui01200  Carbon metabolism
ssui01212  Fatty acid metabolism
ssui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    T15_1653 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    T15_1653 (atoB)
   00640 Propanoate metabolism
    T15_1653 (atoB)
   00650 Butanoate metabolism
    T15_1653 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    T15_1653 (atoB)
   00072 Synthesis and degradation of ketone bodies
    T15_1653 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T15_1653 (atoB)
   00310 Lysine degradation
    T15_1653 (atoB)
   00380 Tryptophan metabolism
    T15_1653 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T15_1653 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T15_1653 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    T15_1653 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssui04147]
    T15_1653 (atoB)
Enzymes [BR:ssui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     T15_1653 (atoB)
Exosome [BR:ssui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   T15_1653 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGZ23740
UniProt: U5UJP9
Position
1656497..1657681
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLVLMSDEKASELNIQPLAYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIAFGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctattgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcaaacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctgggggcattgaaatcatgagccag
gcaccctatctatccaaaactagccggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgcccattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttggtactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatgggacttggacctattaccgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagctttcgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcctttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system