KEGG   Streptococcus suis T15: T15_1828Help
Entry
T15_1828          CDS       T02891                                 

Gene name
glyQ
Definition
(GenBank) glyQ gene product
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ssui  Streptococcus suis T15
Pathway
ssui00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ssui00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T15_1828 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssui01007]
    T15_1828 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssui03016]
    T15_1828 (glyQ)
Enzymes [BR:ssui01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     T15_1828 (glyQ)
Amino acid related enzymes [BR:ssui01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   T15_1828 (glyQ)
Transfer RNA biogenesis [BR:ssui03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    T15_1828 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AGZ23910
UniProt: U5UK59
Position
complement(1804444..1805361)
Genome map
AA seq 305 aa AA seqDB search
MSKKLTFQEIILTLQQFWNEQGCLLMQAYDTEKGAGTMSPYTFLRAIGPEPWNAAYVEPS
RRPADGRYGGNPNRLYQHHQFQVVMKPSPSNIQELYLESLERLGINPLEHDIRFVEDNWE
NPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATGPVTAEVTYGLERLASYIQEVDSVYD
IEWADGVKYGEIFIQPEYEHSKYSFEVSDQDMLLENFTKFEKEAERALEEGLVHPAFDYV
LKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVAERKKLGFPLLDEATRAELL
KEDAE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaaattaacattccaggaaattatcctgaccttacaacaattttggaatgag
caggggtgcttgctcatgcaggcttatgatacggaaaagggtgcggggacaatgagcccg
tacactttcttgcgtgctatcggtcctgagccatggaatgcggcttatgtggagccgtct
cgtcgtccagcagatggtcgttacgggggaaacccaaaccgtttgtatcagcaccaccaa
ttccaagtggttatgaaaccatctccgtctaatatccaagaactctacttggaatctttg
gagcgtttggggatcaatcctttggaacatgacattcgtttcgttgaggataactgggaa
aacccttcaacaggctcagctggtctgggctgggaagtttggttggacggtatggaaatc
acgcagtttacctatttccaacaggtcggtggcttggcaacaggccctgtcacagccgaa
gtaacctatggtttggagcgtctggcttcttacattcaagaagttgactccgtttacgac
atcgagtgggcagacggtgttaaatacggcgaaatctttattcagccagagtatgagcat
tcaaaatattcctttgaagtatccgaccaagatatgctccttgaaaacttcactaagttt
gaaaaagaagcagagcgggctttggaagaaggcttggtccatccagcctttgactatgta
ctcaaatgctctcatacctttaacctgttggatgcccgcggagctgtgtctgtaaccgag
cgtgcaggctacattgcccgtatccgtaaccttgcccgtgtcgttgccaagacctttgtg
gcagagcggaagaaactcggcttcccacttttagacgaagcaacacgagcagaattgttg
aaggaggacgcagaataa

DBGET integrated database retrieval system