KEGG   Streptococcus suis SC070731 (serotype 2): NJAUSS_1367Help
Entry
NJAUSS_1367       CDS       T02536                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ssus  Streptococcus suis SC070731 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ssus03009]
    NJAUSS_1367
Enzymes [BR:ssus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     NJAUSS_1367
Ribosome biogenesis [BR:ssus03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NJAUSS_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 MTS CMAS Methyltransf_9 Ubie_methyltran Methyltransf_32 FtsJ CpXC NodS DUF1726 MetW Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: AGG64829
Position
complement(1456338..1457165)
Genome map
AA seq 275 aa AA seqDB search
MTKHQRFANSDQFFACPHCGQALGLDLNSLRCPNRHTFDIAKQGYVNLAPQVKQSANYHK
SSFENRQAFLEAGYYDHLYEALEEKIAELGLRSVLDIGCGEGFYSRKLAEKMDLDILAFD
ISKDSILLAARTDRTKSVKWFVGDLTKLPIQDKTIDGILDIFSPANYQEFARVLKAGGAI
LKLVPGPNHLKELRHLAKDQLRKESYDNQDIVDHFKSYMGQVEQEVVSRTLPIGIEQARI
LADMTPLFFQVDQSKLDLSQLTEITVEGLLLIGSI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaccaacgttttgccaatagcgaccaatttttcgcctgtccacattgtggg
caggctcttggtcttgacctcaacagccttcgctgccccaaccgccacaccttcgacatt
gccaagcagggctacgtcaacctggcaccccaggtcaagcagtccgccaactaccacaag
tctagctttgaaaaccgtcaggcctttttagaggcgggctattacgatcatctctacgag
gctttggaggaaaaaatagcagagctgggattgcggtctgtcttggacatcggctgtgga
gagggcttttattcccgtaaattagccgagaaaatggacttggacattcttgcttttgat
atttctaaggattctattctcctagcagccagaacagacaggaccaagtcggtcaaatgg
tttgtcggtgacttgaccaagttgcccattcaagacaagaccatcgacgggatcttggac
atcttctccccagccaattatcaggaatttgccagagtgctgaaagctggtggggctatt
ctcaaactagtcccaggccccaatcacctcaaggagctccgccatttagccaaagaccaa
ctccgcaaggagtcctatgacaaccaagatatcgtggaccatttcaagtcttacatggga
caggtggagcaagaggtggtcagccggaccctgccgattggtatagagcaggctcgtatt
ttggcagacatgacacccctctttttccaagtggaccagtccaagctggatttgagtcaa
ttgacggagataacggtggagggcttacttttgattggaagtatataa

DBGET integrated database retrieval system