KEGG   Streptococcus suis SC070731 (serotype 2): NJAUSS_1517Help
Entry
NJAUSS_1517       CDS       T02536                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssus  Streptococcus suis SC070731 (serotype 2)
Pathway
ssus00071  Fatty acid degradation
ssus00072  Synthesis and degradation of ketone bodies
ssus00280  Valine, leucine and isoleucine degradation
ssus00362  Benzoate degradation
ssus00380  Tryptophan metabolism
ssus00620  Pyruvate metabolism
ssus00630  Glyoxylate and dicarboxylate metabolism
ssus00640  Propanoate metabolism
ssus00650  Butanoate metabolism
ssus00900  Terpenoid backbone biosynthesis
ssus01100  Metabolic pathways
ssus01110  Biosynthesis of secondary metabolites
ssus01120  Microbial metabolism in diverse environments
ssus01130  Biosynthesis of antibiotics
ssus01200  Carbon metabolism
ssus01212  Fatty acid metabolism
ssus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NJAUSS_1517
   00630 Glyoxylate and dicarboxylate metabolism
    NJAUSS_1517
   00640 Propanoate metabolism
    NJAUSS_1517
   00650 Butanoate metabolism
    NJAUSS_1517
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NJAUSS_1517
   00072 Synthesis and degradation of ketone bodies
    NJAUSS_1517
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NJAUSS_1517
   00310 Lysine degradation
    NJAUSS_1517
   00380 Tryptophan metabolism
    NJAUSS_1517
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NJAUSS_1517
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NJAUSS_1517
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NJAUSS_1517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssus04147]
    NJAUSS_1517
Enzymes [BR:ssus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NJAUSS_1517
Exosome [BR:ssus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NJAUSS_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AGG64978
Position
1595257..1596441
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system