KEGG   Streptococcus suis SC070731 (serotype 2): NJAUSS_1860Help
Entry
NJAUSS_1860       CDS       T02536                                 

Definition
(GenBank) ribonuclease P
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
ssus  Streptococcus suis SC070731 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssus03016]
    NJAUSS_1860
Enzymes [BR:ssus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     NJAUSS_1860
Transfer RNA biogenesis [BR:ssus03016]
 Prokaryotic type
  5'processing factors
   Ribonucrease P
    NJAUSS_1860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P Hpr_kinase_C
Motif
Other DBs
NCBI-ProteinID: AGG65319
Position
complement(1962605..1962964)
Genome map
AA seq 119 aa AA seqDB search
MKKSYRVKRERDFNDIFTKGNNVANRRFVVYRLPKEQKHFRVGLSVSKKLGNAVMRNKIK
RRIRHILIECQHQLVADDFVIIARKGVEELSYQEMKQNLIHVLKLAKLYQEGVVIEKES
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaagctatcgtgtcaagcgtgaacgagattttaatgacatttttacaaaagga
aacaatgtcgccaatcggaggtttgttgtctaccgattacctaaagagcaaaagcatttc
cgagtaggtttatctgtcagcaaaaaattgggaaacgctgtcatgcgaaataagattaag
cgcaggattcgtcacatcttaattgaatgccaacatcaactggtagcagatgactttgtt
atcattgctcgaaaaggtgtagaggaattgtcctatcaagaaatgaagcaaaacctcatc
catgttttgaaactagctaaactataccaggaaggtgttgtgattgaaaaagaaagttaa

DBGET integrated database retrieval system